Property Summary

NCBI Gene PubMed Count 22
PubMed Score 53.28
PubTator Score 15.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.100 1.9e-03
aldosterone-producing adenoma -1.146 1.6e-02
Atopic dermatitis -1.100 6.7e-03
atypical teratoid / rhabdoid tumor -1.200 1.0e-03
medulloblastoma -1.200 2.0e-03
medulloblastoma, large-cell -1.200 2.4e-03
ovarian cancer 1.900 1.7e-04
pancreatic ductal adenocarcinoma liver m... -2.278 1.5e-02
primary Sjogren syndrome 1.100 1.5e-04
psoriasis 1.400 2.9e-07

Gene RIF (7)

AA Sequence

MEVMEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLL      1 - 70
IQERWKRAQREERLKAQQNTDKDAAAHLQTSHKPSAEDAEGQSPLSQKYSPSTEKCLPEIQGIFDRDPDT     71 - 140
LLYLLQQKSEPAEPCIGSKAPKDDKTIIEEQATKIADLKRHVEFLVAENERLRKENKQLKAEKARLLKGP    141 - 210
IEKELDVDADFVETSELWSLPPHAETATASSTWQKFAANTGKAKDIPIPNLPPLDFPSPELPLMELSEDI    211 - 280
LKGFMNN                                                                   281 - 287
//

Text Mined References (30)

PMID Year Title