Property Summary

NCBI Gene PubMed Count 19
PubMed Score 46.46
PubTator Score 15.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
medulloblastoma, large-cell 6234 9.04303804626215E-6
psoriasis 6685 6.95000581738107E-5
primary Sjogren syndrome 789 1.53131960235826E-4
ovarian cancer 8492 1.71234671875816E-4
atypical teratoid / rhabdoid tumor 4369 5.45700215566861E-4
adult high grade glioma 2148 0.00187092660647003
medulloblastoma 1524 0.00199687998305852
Atopic dermatitis 944 0.00665974293712507
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0145805605012727
aldosterone-producing adenoma 664 0.0157583781709915
Disease Target Count Z-score Confidence
Polycystic Ovary Syndrome 335 3.44 1.7

Expression

  Differential Expression (10)

Synonym

Accession Q96F24 A6PW36 B4DWS0 Q86UR2 Q96NP6 Q9H0S9 Q9H2I2 NRBF-2
Symbols COPR
COPR1
COPR2
NRBF-2

Gene

PDB

4ZEY  

  Ortholog (14)

Gene RIF (4)

PMID Text
26073781 Polymorphisms in a putative enhancer at the 10q21.2 Breast Cancer Risk Locus regulate NRBF2 expression, implicating this gene in the etiology of breast cancer.
25086043 Nrbf2 may interact with the Atg14L-containing Beclin 1-Vps34 protein complex to modulate protein-protein interactions within the complex.
24785657 NRBF2 regulates macroautophagy as a component of Vps34 Complex I.
15610520 The activation domain, their small size (COPR1, 26.9 kDa; COPR2, 32.4 kDa), and strict dependence on AF-2 for interaction distinguish COPR1 and COPR2 from the SMRT/NCoR type of corepressor and may dampen rather than repress NR-mediated gene expression.

AA Sequence

MEVMEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLL      1 - 70
IQERWKRAQREERLKAQQNTDKDAAAHLQTSHKPSAEDAEGQSPLSQKYSPSTEKCLPEIQGIFDRDPDT     71 - 140
LLYLLQQKSEPAEPCIGSKAPKDDKTIIEEQATKIADLKRHVEFLVAENERLRKENKQLKAEKARLLKGP    141 - 210
IEKELDVDADFVETSELWSLPPHAETATASSTWQKFAANTGKAKDIPIPNLPPLDFPSPELPLMELSEDI    211 - 280
LKGFMNN                                                                   281 - 287
//

Text Mined References (27)

PMID Year Title
26073781 2015 Polymorphisms in a Putative Enhancer at the 10q21.2 Breast Cancer Risk Locus Regulate NRBF2 Expression.
25416956 2014 A proteome-scale map of the human interactome network.
25086043 2014 Nrbf2 protein suppresses autophagy by modulating Atg14L protein-containing Beclin 1-Vps34 complex architecture and reducing intracellular phosphatidylinositol-3 phosphate levels.
24849286 2014 NRBF2 regulates autophagy and prevents liver injury by modulating Atg14L-linked phosphatidylinositol-3 kinase III activity.
24823311 2014 Genome-wide association study of plasma N6 polyunsaturated fatty acids within the cohorts for heart and aging research in genomic epidemiology consortium.
24785657 2014 NRBF2 regulates macroautophagy as a component of Vps34 Complex I.
24026423 2014 A genome- and phenome-wide association study to identify genetic variants influencing platelet count and volume and their pleiotropic effects.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22354037 2012 Genome-wide siRNA screen reveals amino acid starvation-induced autophagy requires SCOC and WAC.
22001757 2011 Genome-wide association study identifies loci influencing concentrations of liver enzymes in plasma.
More...