Property Summary

NCBI Gene PubMed Count 21
PubMed Score 40.85
PubTator Score 14.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
lung cancer 4740 7.1e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Multiple Sclerosis 540 0.0 1.0
Disease Target Count Z-score Confidence
Lymphopenia 67 5.387 2.7
diabetes mellitus 1728 3.178 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
lung cancer -1.800 7.1e-05

Gene RIF (13)

AA Sequence

MGGFQRGKYGTMAEGRSEDNLSATPPALRIILVGKTGCGKSATGNSILGQPVFESKLRAQSVTRTCQVKT      1 - 70
GTWNGRKVLVVDTPSIFESQADTQELYKNIGDCYLLSAPGPHVLLLVIQLGRFTAQDTVAIRKVKEVFGT     71 - 140
GAMRHVVILFTHKEDLGGQALDDYVANTDNCSLKDLVRECERRYCAFNNWGSVEEQRQQQAELLAVIERL    141 - 210
GREREGSFHSNDLFLDAQLLQRTGAGACQEDYRQYQAKVEWQVEKHKQELRENESNWAYKALLRVKHLML    211 - 280
LHYEIFVFLLLCSILFFIIFLFIFHYI                                               281 - 307
//

Text Mined References (22)

PMID Year Title