Property Summary

NCBI Gene PubMed Count 20
Grant Count 26
R01 Count 5
Funding $3,027,586
PubMed Score 38.99
PubTator Score 14.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
lung cancer -1.800 0.000

Gene RIF (12)

PMID Text
25944983 gimap5 has a role in maintaining peripheral tolerance and T cell homeostasis in the gut [review]
23098229 Data indicate that overexpression of GTPase of the immune-associated nucleotide-binding protein 5 (GIMAP5) in HEK (human embryonic kidney)-293 cells resulted in increased Ca2+ accumulation within the mitochondria.
20817506 Notch signalling protects T-ALL cells from apoptosis by upregulating the expression of GIMAP5.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20190135 These data establish Gimap5 as a key regulator of hematopoietic integrity and lymphocyte homeostasis
19762377 Data show that IAN5 polymorphisms are associated with susceptibility to Systemic lupus erythematosus and the development of clinical disease manifestations in a strictly Korean population.
19762377 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17641683 Observational study of gene-disease association. (HuGE Navigator)
17641683 These data suggest that the GIMAP5 gene is associated with islet autoimmunity in type I diabetes and add to recent findings implicating the same single nucleotide polymorphism in another autoimmune disease.
17369194 Resutls show that Gimap5 is located in the endoplasmic reticulum, and the endogenous Gimap5 mRNA is up-regulated in activated T-cells.
More...

AA Sequence

MGGFQRGKYGTMAEGRSEDNLSATPPALRIILVGKTGCGKSATGNSILGQPVFESKLRAQSVTRTCQVKT      1 - 70
GTWNGRKVLVVDTPSIFESQADTQELYKNIGDCYLLSAPGPHVLLLVIQLGRFTAQDTVAIRKVKEVFGT     71 - 140
GAMRHVVILFTHKEDLGGQALDDYVANTDNCSLKDLVRECERRYCAFNNWGSVEEQRQQQAELLAVIERL    141 - 210
GREREGSFHSNDLFLDAQLLQRTGAGACQEDYRQYQAKVEWQVEKHKQELRENESNWAYKALLRVKHLML    211 - 280
LHYEIFVFLLLCSILFFIIFLFIFHYI                                               281 - 307
//

Text Mined References (21)

PMID Year Title
25944983 2015 Central role of gimap5 in maintaining peripheral tolerance and T cell homeostasis in the gut.
25416956 2014 A proteome-scale map of the human interactome network.
23098229 2013 GTPase of the immune-associated nucleotide-binding protein 5 (GIMAP5) regulates calcium influx in T-lymphocytes by promoting mitochondrial calcium accumulation.
21487483 2010 The autoimmunity-related GIMAP5 GTPase is a lysosome-associated protein.
20817506 2010 Notch protection against apoptosis in T-ALL cells mediated by GIMAP5.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20190135 2010 Loss of T cell and B cell quiescence precedes the onset of microbial flora-dependent wasting disease and intestinal inflammation in Gimap5-deficient mice.
19762377 2009 IAN5 polymorphisms are associated with systemic lupus erythematosus.
17641683 2007 IA-2 autoantibodies in incident type I diabetes patients are associated with a polyadenylation signal polymorphism in GIMAP5.
17369194 2007 Both Gimap5 and the diabetogenic BBDP allele of Gimap5 induce apoptosis in T cells.
More...