Property Summary

NCBI Gene PubMed Count 20
PubMed Score 10.21
PubTator Score 82.01

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96F10
Symbols SSAT2

Gene

PDB

2BEI   2Q4V  

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Gene RIF (9)

AA Sequence

MASVRIREAKEGDCGDILRLIRELAEFEKLSDQVKISEEALRADGFGDNPFYHCLVAEILPAPGKLLGPC      1 - 70
VVGYGIYYFIYSTWKGRTIYLEDIYVMPEYRGQGIGSKIIKKVAEVALDKGCSQFRLAVLDWNQRAMDLY     71 - 140
KALGAQDLTEAEGWHFFCFQGEATRKLAGK                                            141 - 170
//

Text Mined References (22)

PMID Year Title