Property Summary

NCBI Gene PubMed Count 34
PubMed Score 22.95
PubTator Score 14.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
adult high grade glioma -2.500 5.7e-09
astrocytic glioma -1.400 1.8e-02
Astrocytoma, Pilocytic -1.200 2.3e-05
atypical teratoid / rhabdoid tumor -2.300 5.1e-10
cutaneous lupus erythematosus 1.500 8.1e-03
cystic fibrosis -1.831 3.7e-06
ductal carcinoma in situ 1.200 1.0e-02
ependymoma -1.900 2.3e-02
glioblastoma -2.100 5.3e-09
group 4 medulloblastoma -1.500 1.3e-07
interstitial cystitis 1.100 1.2e-02
lung cancer -1.400 3.7e-02
lung carcinoma 1.700 2.1e-25
medulloblastoma, large-cell -2.000 2.9e-05
non-small cell lung cancer -1.165 5.6e-10
oligodendroglioma -1.200 4.4e-13
osteosarcoma -2.436 2.2e-02
Pick disease -1.200 7.2e-03
pituitary cancer -1.200 1.2e-06
primary Sjogren syndrome 1.100 3.0e-02
primitive neuroectodermal tumor -1.300 9.5e-04
subependymal giant cell astrocytoma -2.080 2.3e-02
tuberculosis 1.100 3.3e-06

Gene RIF (9)

AA Sequence

MTTHVTLEDALSNVDLLEELPLPDQQPCIEPPPSSIMYQANFDTNFEDRNAFVTGIARYIEQATVHSSMN      1 - 70
EMLEEGHEYAVMLYTWRSCSRAIPQVKCNEQPNRVEIYEKTVEVLEPEVTKLMKFMYFQRKAIERFCSEV     71 - 140
KRLCHAERRKDFVSEAYLLTLGKFINMFAVLDELKNMKCSVKNDHSAYKRAAQFLRKMADPQSIQESQNL    141 - 210
SMFLANHNRITQCLHQQLEVIPGYEELLADIVNICVDYYENKMYLTPSEKHMLLKVMGFGLYLMDGNVSN    211 - 280
IYKLDAKKRINLSKIDKFFKQLQVVPLFGDMQIELARYIKTSAHYEENKSKWTCTQSSISPQYNICEQMV    281 - 350
QIRDDHIRFISELARYSNSEVVTGSGLDSQKSDEEYRELFDLALRGLQLLSKWSAHVMEVYSWKLVHPTD    351 - 420
KFCNKDCPGTAEEYERATRYNYTSEEKFAFVEVIAMIKGLQVLMGRMESVFNQAIRNTIYAALQDFAQVT    421 - 490
LREPLRQAVRKKKNVLISVLQAIRKTICDWEGGREPPNDPCLRGEKDPKGGFDIKVPRRAVGPSSTQACQ    491 - 560
WSPRALFHPTGGTQGRRGCRSLLYMVRTMLESLIADKSGSKKTLRSSLDGPIVLAIEDFHKQSFFFTHLL    561 - 630
NISEALQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILETKEPSMMEYVLYPLDLYNDSAY    631 - 700
YALTKFKKQFLYDEIEAEVNLCFDQFVYKLADQIFAYYKAMAGSVLLDKRFRAECKNYGVIIPYPPSNRY    701 - 770
ETLLKQRHVQLLGRSIDLNRLITQRISAAMYKSLDQAISRFESEDLTSIVELEWLLEINRLTHRLLCKHM    771 - 840
TLDSFDAMFREANHNVSAPYGRITLHVFWELNFDFLPNYCYNGSTNRFVRTAIPFTQEPQRDKPANVQPY    841 - 910
YLYGSKPLNIAYSHIYSSYRNFVGPPHFKTICRLLGYQGIAVVMEELLKIVKSLLQGTILQYVKTLIEVM    911 - 980
PKICRLPRHEYGSPGILEFFHHQLKDIIEYAELKTDVFQSLREVGNAILFCLLIEQALSQEEVCDLLHAA    981 - 1050
PFQNILPRVYIKEGERLEVRMKRLEAKYAPLHLVPLIERLGTPQQIAIAREGDLLTKERLCCGLSMFEVI   1051 - 1120
LTRIRSYLQDPIWRGPPPTNGVMHVDECVEFHRLWSAMQFVYCIPVGTNEFTAEQCFGDGLNWAGCSIIV   1121 - 1190
LLGQQRRFDLFDFCYHLLKVQRQDGKDEIIKNVPLKKMADRIRKYQILNNEVFAILNKYMKSVETDSSTV   1191 - 1260
EHVRCFQPPIHQSLATTC                                                       1261 - 1278
//

Text Mined References (37)

PMID Year Title