Property Summary

NCBI Gene PubMed Count 34
Grant Count 24
R01 Count 21
Funding $1,171,615.56
PubMed Score 20.19
PubTator Score 14.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
astrocytic glioma -1.400 0.018
ependymoma -2.200 0.000
cutaneous lupus erythematosus 1.600 0.002
glioblastoma -2.900 0.000
oligodendroglioma -1.200 0.000
osteosarcoma -2.456 0.004
sonic hedgehog group medulloblastoma -1.900 0.000
cystic fibrosis -1.831 0.000
atypical teratoid / rhabdoid tumor -2.300 0.000
medulloblastoma, large-cell -2.100 0.000
primitive neuroectodermal tumor -1.300 0.001
tuberculosis 1.100 0.000
non-small cell lung cancer -1.165 0.000
lung cancer -1.400 0.037
interstitial cystitis 1.100 0.012
pediatric high grade glioma -2.700 0.000
pilocytic astrocytoma -1.200 0.000
primary Sjogren syndrome 1.700 0.000
subependymal giant cell astrocytoma -2.080 0.023
lung carcinoma 1.700 0.000
Pick disease -1.200 0.007
ductal carcinoma in situ 1.200 0.010
pituitary cancer -1.200 0.000

Gene RIF (8)

PMID Text
22430187 blood samples of lateral sclerosis patients were found to have significantly different levels of expression of CyFIP2 and RbBP9 compared to the levels of expression in control subjects.
22268788 Increased expression of the cytoplasmic FMR1-interacting protein 2 (CYFIP2), a known FMRP interactor, is detected in fragile X syndrome.
21252116 Studies identify a novel proapoptotic gene target, CYFIP2, which is downregulated by IMP-1, and mediates the regulation of cell survival and K-Ras expression in colon cancer cells.
20228810 Protein complexes containing CYFIP/Sra/PIR121 coordinate Arf1 and Rac1 signalling during clathrin-AP-1-coated carrier biogenesis at the trans-golgi network.
19951440 Observational study of gene-disease association. (HuGE Navigator)
19910030 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19247692 Observational study of gene-disease association. (HuGE Navigator)
17245118 The CYFIP2 promoter contains a p53-responsive element that confers p53 binding as well as transcriptional activation of a heterologous reporter.

AA Sequence

MTTHVTLEDALSNVDLLEELPLPDQQPCIEPPPSSIMYQANFDTNFEDRNAFVTGIARYIEQATVHSSMN      1 - 70
EMLEEGHEYAVMLYTWRSCSRAIPQVKCNEQPNRVEIYEKTVEVLEPEVTKLMKFMYFQRKAIERFCSEV     71 - 140
KRLCHAERRKDFVSEAYLLTLGKFINMFAVLDELKNMKCSVKNDHSAYKRAAQFLRKMADPQSIQESQNL    141 - 210
SMFLANHNRITQCLHQQLEVIPGYEELLADIVNICVDYYENKMYLTPSEKHMLLKVMGFGLYLMDGNVSN    211 - 280
IYKLDAKKRINLSKIDKFFKQLQVVPLFGDMQIELARYIKTSAHYEENKSKWTCTQSSISPQYNICEQMV    281 - 350
QIRDDHIRFISELARYSNSEVVTGSGLDSQKSDEEYRELFDLALRGLQLLSKWSAHVMEVYSWKLVHPTD    351 - 420
KFCNKDCPGTAEEYERATRYNYTSEEKFAFVEVIAMIKGLQVLMGRMESVFNQAIRNTIYAALQDFAQVT    421 - 490
LREPLRQAVRKKKNVLISVLQAIRKTICDWEGGREPPNDPCLRGEKDPKGGFDIKVPRRAVGPSSTQACQ    491 - 560
WSPRALFHPTGGTQGRRGCRSLLYMVRTMLESLIADKSGSKKTLRSSLDGPIVLAIEDFHKQSFFFTHLL    561 - 630
NISEALQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILETKEPSMMEYVLYPLDLYNDSAY    631 - 700
YALTKFKKQFLYDEIEAEVNLCFDQFVYKLADQIFAYYKAMAGSVLLDKRFRAECKNYGVIIPYPPSNRY    701 - 770
ETLLKQRHVQLLGRSIDLNRLITQRISAAMYKSLDQAISRFESEDLTSIVELEWLLEINRLTHRLLCKHM    771 - 840
TLDSFDAMFREANHNVSAPYGRITLHVFWELNFDFLPNYCYNGSTNRFVRTAIPFTQEPQRDKPANVQPY    841 - 910
YLYGSKPLNIAYSHIYSSYRNFVGPPHFKTICRLLGYQGIAVVMEELLKIVKSLLQGTILQYVKTLIEVM    911 - 980
PKICRLPRHEYGSPGILEFFHHQLKDIIEYAELKTDVFQSLREVGNAILFCLLIEQALSQEEVCDLLHAA    981 - 1050
PFQNILPRVYIKEGERLEVRMKRLEAKYAPLHLVPLIERLGTPQQIAIAREGDLLTKERLCCGLSMFEVI   1051 - 1120
LTRIRSYLQDPIWRGPPPTNGVMHVDECVEFHRLWSAMQFVYCIPVGTNEFTAEQCFGDGLNWAGCSIIV   1121 - 1190
LLGQQRRFDLFDFCYHLLKVQRQDGKDEIIKNVPLKKMADRIRKYQILNNEVFAILNKYMKSVETDSSTV   1191 - 1260
EHVRCFQPPIHQSLATTC                                                       1261 - 1278
//

Text Mined References (37)

PMID Year Title
24658146 2014 Subcellular fractionation and localization studies reveal a direct interaction of the fragile X mental retardation protein (FMRP) with nucleolin.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
22430187 2012 Two potential biomarkers identified in mesenchymal stem cells and leukocytes of patients with sporadic amyotrophic lateral sclerosis.
22268788 2012 Altered mTOR signaling and enhanced CYFIP2 expression levels in subjects with fragile X syndrome.
21269460 2011 Initial characterization of the human central proteome.
21252116 2011 IMP-1 displays cross-talk with K-Ras and modulates colon cancer cell survival through the novel proapoptotic protein CYFIP2.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20228810 2010 Protein complexes containing CYFIP/Sra/PIR121 coordinate Arf1 and Rac1 signalling during clathrin-AP-1-coated carrier biogenesis at the TGN.
19951440 2009 Analyses of associations between three positionally cloned asthma candidate genes and asthma or asthma-related phenotypes in a Chinese population.
More...