Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.92
PubTator Score 1.33

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
Barrett's esophagus 1.100 3.3e-02
interstitial cystitis 1.100 5.0e-04
intraductal papillary-mucinous carcinoma... 1.100 1.9e-03
lung adenocarcinoma 1.200 6.7e-11
non primary Sjogren syndrome sicca 1.100 2.8e-02
ovarian cancer 2.700 1.1e-06

AA Sequence

MWTALVLIWIFSLSLSESHAASNDPRNFVPNKMWKGLVKRNASVETVDNKTSEDVTMAAASPVTLTKGTS      1 - 70
AAHLNSMEVTTEDTSRTDVSEPATSGGAADGVTSIAPTAVASSTTAASITTAASSMTVASSAPTTAASST     71 - 140
TVASIAPTTAASSMTAASSTPMTLALPAPTSTSTGRTPSTTATGHPSLSTALAQVPKSSALPRTATLATL    141 - 210
ATRAQTVATTANTSSPMSTRPSPSKHMPSDTAASPVPPMRPQAQGPISQVSVDQPVVNTTNKSTPMPSNT    211 - 280
TPEPAPTPTVVTTTKAQAREPTASPVPVPHTSPIPEMEAMSPTTQPSPMPYTQRAAGPGTSQAPEQVETE    281 - 350
ATPGTDSTGPTPRSSGGTKMPATDSCQPSTQGQYMVVTTEPLTQAVVDKTLLLVVLLLGVTLFITVLVLF    351 - 420
ALQAYESYKKKDYTQVDYLINGMYADSEM                                             421 - 449
//

Text Mined References (7)

PMID Year Title