Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.92
PubTator Score 1.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

AA Sequence

MWTALVLIWIFSLSLSESHAASNDPRNFVPNKMWKGLVKRNASVETVDNKTSEDVTMAAASPVTLTKGTS      1 - 70
AAHLNSMEVTTEDTSRTDVSEPATSGGAADGVTSIAPTAVASSTTAASITTAASSMTVASSAPTTAASST     71 - 140
TVASIAPTTAASSMTAASSTPMTLALPAPTSTSTGRTPSTTATGHPSLSTALAQVPKSSALPRTATLATL    141 - 210
ATRAQTVATTANTSSPMSTRPSPSKHMPSDTAASPVPPMRPQAQGPISQVSVDQPVVNTTNKSTPMPSNT    211 - 280
TPEPAPTPTVVTTTKAQAREPTASPVPVPHTSPIPEMEAMSPTTQPSPMPYTQRAAGPGTSQAPEQVETE    281 - 350
ATPGTDSTGPTPRSSGGTKMPATDSCQPSTQGQYMVVTTEPLTQAVVDKTLLLVVLLLGVTLFITVLVLF    351 - 420
ALQAYESYKKKDYTQVDYLINGMYADSEM                                             421 - 449
//

Text Mined References (7)

PMID Year Title
24312644 2013 C11ORF24 is a novel type I membrane protein that cycles between the Golgi apparatus and the plasma membrane in Rab6-positive vesicles.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11401438 2001 The sequence and gene characterization of a 400-kb candidate region for IDDM4 on chromosome 11q13.