Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.92
PubTator Score 1.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung adenocarcinoma 2714 6.74852619121606E-11
ovarian cancer 8492 1.11331177491882E-6
interstitial cystitis 2299 4.9892437885272E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00188493330039922
non primary Sjogren syndrome sicca 840 0.0275071109245173
Barrett's esophagus 185 0.032857846643712

Expression

  Differential Expression (6)

Synonym

Accession Q96F05 Q9H2K4
Symbols DM4E3

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG

AA Sequence

MWTALVLIWIFSLSLSESHAASNDPRNFVPNKMWKGLVKRNASVETVDNKTSEDVTMAAASPVTLTKGTS      1 - 70
AAHLNSMEVTTEDTSRTDVSEPATSGGAADGVTSIAPTAVASSTTAASITTAASSMTVASSAPTTAASST     71 - 140
TVASIAPTTAASSMTAASSTPMTLALPAPTSTSTGRTPSTTATGHPSLSTALAQVPKSSALPRTATLATL    141 - 210
ATRAQTVATTANTSSPMSTRPSPSKHMPSDTAASPVPPMRPQAQGPISQVSVDQPVVNTTNKSTPMPSNT    211 - 280
TPEPAPTPTVVTTTKAQAREPTASPVPVPHTSPIPEMEAMSPTTQPSPMPYTQRAAGPGTSQAPEQVETE    281 - 350
ATPGTDSTGPTPRSSGGTKMPATDSCQPSTQGQYMVVTTEPLTQAVVDKTLLLVVLLLGVTLFITVLVLF    351 - 420
ALQAYESYKKKDYTQVDYLINGMYADSEM                                             421 - 449
//

Text Mined References (7)

PMID Year Title
24312644 2013 C11ORF24 is a novel type I membrane protein that cycles between the Golgi apparatus and the plasma membrane in Rab6-positive vesicles.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11401438 2001 The sequence and gene characterization of a 400-kb candidate region for IDDM4 on chromosome 11q13.