Property Summary

NCBI Gene PubMed Count 48
Grant Count 4
Funding $123,497.5
PubMed Score 31.30
PubTator Score 48.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
ovarian cancer 8,484

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.200 0.000

Synonym

Accession Q96EZ8 O14742 O75497 Q6VN53 Q7Z372
Symbols P78
MCRS2
MSP58
INO80Q
ICP22BP

Gene

Gene RIF (27)

PMID Text
27468560 Suggest that MSP58 plays an important role in tumorigenesis and progression and may help predict the prognosis of gastric cancer patients.
26849376 The immunoreactivity score (IRS) of MSP58 increased with tumor grade with grade IV gliomas exhibiting the highest expression and showed a highly significant positive correlation with the Ki-67 index (r = 0.65, P < 0.001).
26467212 MCRS1 overexpression induced non-small cell lung cancer proliferation through the miR-155-Rb1 pathway and DNA copy-number amplification is one of the mechanisms underlying MCRS1 overexpression in non-small cell lung cancer.
26300492 BAP1 loss and MCRS1 down-regulation in renal cell carcinoma are associated with adverse clinicopathological features.
25981436 MSP58 subnuclear localization is regulated by two nuclear import signals, and proper subcellular localization of MSP58 is critical for its role in transcriptional regulation. A molecular mechanism controls nuclear and nucleolar localization of MSP58.
25373388 MiR-129* down-regulation induced MCRS1 overexpression.
24361335 MSP58 could suppress the transcription of hTERT promoter.
23996240 High expression of MSP58 was also an independent unfavorable prognostic factor.
23519485 MSP58 expression in hepatocellular carcinoma is closely related to the prognosis.
23225332 RACGAP1 and MCRS1 overexpression in nonsmall-cell lung cancer.RACGAP1 and MCRS1 may be cancer-related genes in NSCLC.
More...

AA Sequence

MDKDSQGLLDSSLMASGTASRSEDEESLAGQKRASSQALGTIPKRRSSSRFIKRKKFDDELVESSLAKSS      1 - 70
TRAKGASGVEPGRCSGSEPSSSEKKKVSKAPSTPVPPSPAPAPGLTKRVKKSKQPLQVTKDLGRWKPADD     71 - 140
LLLINAVLQTNDLTSVHLGVKFSCRFTLREVQERWYALLYDPVISKLACQAMRQLHPEAIAAIQSKALFS    141 - 210
KAEEQLLSKVGSTSQPTLETFQDLLHRHPDAFYLARTAKALQAHWQLMKQYYLLEDQTVQPLPKGDQVLN    211 - 280
FSDAEDLIDDSKLKDMRDEVLEHELMVADRRQKREIRQLEQELHKWQVLVDSITGMSSPDFDNQTLAVLR    281 - 350
GRMVRYLMRSREITLGRATKDNQIDVDLSLEGPAWKISRKQGVIKLKNNGDFFIANEGRRPIYIDGRPVL    351 - 420
CGSKWRLSNNSVVEIASLRFVFLINQDLIALIRAEAAKITPQ                                421 - 462
//

Text Mined References (59)

PMID Year Title
27468560 2016 Increased Expression of 58-kDa Microspherule Protein (MSP58) in Human Gastric Cancer Promotes Cell Proliferation and Correlates with Poor Patient Survival.
26849376 2016 Expression of 58-kD Microspherule Protein (MSP58) is Highly Correlated with PET Imaging of Tumor Malignancy and Cell Proliferation in Glioma Patients.
26467212 2015 The candidate oncogene (MCRS1) promotes the growth of human lung cancer cells via the miR-155-Rb1 pathway.
26300492 2015 Stabilization of MCRS1 by BAP1 prevents chromosome instability in renal cell carcinoma.
25981436 2015 Identification and characterization of nuclear and nucleolar localization signals in 58-kDa microspherule protein (MSP58).
25416956 2014 A proteome-scale map of the human interactome network.
25373388 2014 MCRS1 overexpression, which is specifically inhibited by miR-129*, promotes the epithelial-mesenchymal transition and metastasis in non-small cell lung cancer.
24361335 2014 The 58-kda microspherule protein (MSP58) represses human telomerase reverse transcriptase (hTERT) gene expression and cell proliferation by interacting with telomerase transcriptional element-interacting factor (TEIF).
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23996240 2013 Increased expression of the 58-kD microspherule protein (MSP58) is correlated with poor prognosis in glioma patients.
More...