Property Summary

NCBI Gene PubMed Count 14
PubMed Score 15.43
PubTator Score 5.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Gene RIF (8)

AA Sequence

MALRICVTYTPALPIGLCTRCCLCLEQSPSWCHCLRGVSFLTFHLHQSVPLGDRDSLLMFTRQAGHFVEG      1 - 70
SKAGRSRGRLCLSQALRVAVRGAFVSLWFAAGAGDRERNKGDKGAQTGAGLSQEAEDVDVSRARRVTDAP     71 - 140
QGTLCGTGNRNSGSQSARVVGVAHLGEAFRVGVEQAISSCPEEVHGRHGLSMEIMWARMDVALRSPGRGL    141 - 210
LAGAGALCMTLAESSCPDYERGRRACLTLHRHPTPHCSTWGLPLRVAGSWLTVVTVEALGGWRMGVRRTG    211 - 280
QVGPTMHPPPVSGASPLLLHHLLLLLLIIILTC                                         281 - 313
//

Text Mined References (15)

PMID Year Title