Property Summary

NCBI Gene PubMed Count 7
PubMed Score 24.07
PubTator Score 7.58

Knowledge Summary

Patent

No data available

Synonym

Accession Q96EY9
Symbols TAD3
MRT36
FWP005
MST121
S863-5
MSTP121

Gene

PANTHER Protein Class (2)

Gene RIF (1)

PMID Text
23620220 A single missense mutation was identified in ADAT3 in all studied families on an ancient ancestral haplotype.

AA Sequence

MEPAPGLVEQPKCLEAGSPEPEPAPWQALPVLSEKQSGDVELVLAYAAPVLDKRQTSRLLKEVSALHPLP      1 - 70
AQPHLKRVRPSRDAGSPHALEMLLCLAGPASGPRSLAELLPRPAVDPRGLGQPFLVPVPARPPLTRGQFE     71 - 140
EARAHWPTSFHEDKQVTSALAGRLFSTQERAAMQSHMERAVWAARRAAARGLRAVGAVVVDPASDRVLAT    141 - 210
GHDCSCADNPLLHAVMVCVDLVARGQGRGTYDFRPFPACSFAPAAAPQAVRAGAVRKLDADEDGLPYLCT    211 - 280
GYDLYVTREPCAMCAMALVHARILRVFYGAPSPDGALGTRFRIHARPDLNHRFQVFRGVLEEQCRWLDPD    281 - 350
T//

Text Mined References (11)

PMID Year Title
26842963 2016 ADAT3-related intellectual disability: Further delineation of the phenotype.
25916855 2015 Inosine modifications in human tRNAs are incorporated at the precursor tRNA level.
25263703 2014 A-to-I editing on tRNAs: biochemical, biological and evolutionary implications.
23620220 2013 Mutation in ADAT3, encoding adenosine deaminase acting on transfer RNA, causes intellectual disability and strabismus.
21269460 2011 Initial characterization of the human central proteome.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...