Property Summary

NCBI Gene PubMed Count 7
PubMed Score 24.06
PubTator Score 7.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
MENTAL RETARDATION, AUTOSOMAL RECESSIVE 36 1 0.0 0.0
Disease Target Count Z-score Confidence
Intellectual disability 1016 0.0 4.0
Disease Target Count Z-score Confidence
Oppositional defiant disorder 17 3.284 1.6
Atopic dermatitis 952 3.059 1.5

Expression

Synonym

Accession Q96EY9
Symbols TAD3
MRT36
FWP005
MST121
S863-5
MSTP121

Gene

  Ortholog (1)

Species Source Disease
Mouse EggNOG Inparanoid

Gene RIF (2)

AA Sequence

MEPAPGLVEQPKCLEAGSPEPEPAPWQALPVLSEKQSGDVELVLAYAAPVLDKRQTSRLLKEVSALHPLP      1 - 70
AQPHLKRVRPSRDAGSPHALEMLLCLAGPASGPRSLAELLPRPAVDPRGLGQPFLVPVPARPPLTRGQFE     71 - 140
EARAHWPTSFHEDKQVTSALAGRLFSTQERAAMQSHMERAVWAARRAAARGLRAVGAVVVDPASDRVLAT    141 - 210
GHDCSCADNPLLHAVMVCVDLVARGQGRGTYDFRPFPACSFAPAAAPQAVRAGAVRKLDADEDGLPYLCT    211 - 280
GYDLYVTREPCAMCAMALVHARILRVFYGAPSPDGALGTRFRIHARPDLNHRFQVFRGVLEEQCRWLDPD    281 - 350
T//

Text Mined References (11)

PMID Year Title