Property Summary

NCBI Gene PubMed Count 37
PubMed Score 63.74
PubTator Score 170.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Expression

  Differential Expression (3)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.200 2.7e-02
ovarian cancer -2.000 6.6e-05
pancreatic ductal adenocarcinoma liver m... -1.476 1.5e-02

Gene RIF (22)

AA Sequence

MAVCGLGSRLGLGSRLGLRGCFGAARLLYPRFQSRGPQGVEDGDRPQPSSKTPRIPKIYTKTGDKGFSST      1 - 70
FTGERRPKDDQVFEAVGTTDELSSAIGFALELVTEKGHTFAEELQKIQCTLQDVGSALATPCSSAREAHL     71 - 140
KYTTFKAGPILELEQWIDKYTSQLPPLTAFILPSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVA    141 - 210
KFLNRLSDYLFTLARYAAMKEGNQEKIYMKNDPSAESEGL                                  211 - 250
//

Text Mined References (39)

PMID Year Title