Property Summary

NCBI Gene PubMed Count 17
PubMed Score 2.98
PubTator Score 4.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Rectum cancer 12 3.317 1.7

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.200 7.0e-04
glioblastoma -1.200 9.5e-03
intraductal papillary-mucinous adenoma (... 1.100 7.5e-03
lung cancer 2.500 1.8e-04
medulloblastoma, large-cell -1.200 2.6e-04
osteosarcoma -2.056 7.5e-07
ovarian cancer -1.300 6.2e-06

Protein-protein Interaction (2)

Gene RIF (6)

AA Sequence

MAVVSAVRWLGLRSRLGQPLTGRRAGLCEQARSCRFYSGSATLSKVEGTDVTGIEEVVIPKKKTWDKVAV      1 - 70
LQALASTVNRDTTAVPYVFQDDPYLMPASSLESRSFLLAKKSGENVAKFIINSYPKYFQKDIAEPHIPCL     71 - 140
MPEYFEPQIKDISEAALKERIELRKVKASVDMFDQLLQAGTTVSLETTNSLLDLLCYYGDQEPSTDYHFQ    141 - 210
QTGQSEALEEENDETSRRKAGHQFGVTWRAKNNAERIFSLMPEKNEHSYCTMIRGMVKHRAYEQALNLYT    211 - 280
ELLNNRLHADVYTFNALIEATVCAINEKFEEKWSKILELLRHMVAQKVKPNLQTFNTILKCLRRFHVFAR    281 - 350
SPALQVLREMKAIGIEPSLATYHHIIRLFDQPGDPLKRSSFIIYDIMNELMGKRFSPKDPDDDKFFQSAM    351 - 420
SICSSLRDLELAYQVHGLLKTGDNWKFIGPDQHRNFYYSKFFDLICLMEQIDVTLKWYEDLIPSAYFPHS    421 - 490
QTMIHLLQALDVANRLEVIPKIWKDSKEYGHTFRSDLREEILMLMARDKHPPELQVAFADCAADIKSAYE    491 - 560
SQPIRQTAQDWPATSLNCIAILFLRAGRTQEAWKMLGLFRKHNKIPRSELLNELMDSAKVSNSPSQAIEV    561 - 630
VELASAFSLPICEGLTQRVMSDFAINQEQKEALSNLTALTSDSDTDSSSDSDSDTSEGK               631 - 689
//

Text Mined References (27)

PMID Year Title