Property Summary

NCBI Gene PubMed Count 12
Grant Count 2
Funding $123,748.9
PubMed Score 51.70
PubTator Score 3.60

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96EY5 Q96I18
Symbols CFBP
FAM125A

Gene

 Grant Application (2)

Gene RIF (3)

PMID Text
20654576 These results suggest that the expression of MVB12B may be normally suppressed through the ubiquitin-proteasome pathway that simultaneously regulates the fate of MVB12A and the functions of ESCRT-I.
18005716 ESCRT-I complexes contain three common subunits (TSG101, VPS28, and VPS37), and a fourth subunit MVB12. Recombinant ESCRT-I complexes bind HIV-1 p6
16895919 CFBP is a novel tyrosine-phosphorylated protein that might function as a regulator of CIN85/CD2AP

AA Sequence

MDPVPGTDSAPLAGLAWSSASAPPPRGFSAISCTVEGAPASFGKSFAQKSGYFLCLSSLGSLENPQENVV      1 - 70
ADIQIVVDKSPLPLGFSPVCDPMDSKASVSKKKRMCVKLLPLGATDTAVFDVRLSGKTKTVPGYLRIGDM     71 - 140
GGFAIWCKKAKAPRPVPKPRGLSRDMQGLSLDAASQPSKGGLLERTASRLGSRASTLRRNDSIYEASSLY    141 - 210
GISAMDGVPFTLHPRFEGKSCSPLAFSAFGDLTIKSLADIEEEYNYGFVVEKTAAARLPPSVS           211 - 273
//

Text Mined References (20)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22232651 2012 Structural basis for membrane targeting by the MVB12-associated ?-prism domain of the human ESCRT-I MVB12 subunit.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20654576 2010 Distinct functions of human MVB12A and MVB12B in the ESCRT-I dependent on their posttranslational modifications.
20588296 2010 Membrane budding and scission by the ESCRT machinery: it's all in the neck.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...