Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.09
PubTator Score 0.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
hepatocellular carcinoma 1.500 0.000
pancreatic cancer 1.200 0.009
glioblastoma 1.300 0.000
sonic hedgehog group medulloblastoma 2.200 0.000
medulloblastoma, large-cell 2.300 0.000
lung cancer 1.800 0.006
colon cancer 1.200 0.001
Breast cancer 3.000 0.025
pediatric high grade glioma 1.300 0.001
atypical teratoid/rhabdoid tumor 1.100 0.009
pancreatic carcinoma 1.200 0.009
nasopharyngeal carcinoma 1.300 0.001

AA Sequence

MPKAPKGKSAGREKKVIHPYSRKAAQITREAHKQEKKEKLKNEKALRLNLVGEKLQWFQNHLDPQKKRYS      1 - 70
KKDACELIERYLNRFSSELEQIELHNSIRDRQGRRHCSRETVIKQTMERERQQFEGYGLEIPDILNASNL     71 - 140
KTFREWDFDLKKLPNIKMRKICANDAIPKTCKRKTIITVDQDLGELELNDESSDSDEEMTAVA           141 - 203
//

Text Mined References (9)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.