Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.09
PubTator Score 0.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
sonic hedgehog group medulloblastoma 1482 3.28516931073192E-6
hepatocellular carcinoma 550 7.59272127990367E-5
glioblastoma 5572 1.62376971493848E-4
medulloblastoma, large-cell 6234 3.85111007153427E-4
nasopharyngeal carcinoma 1056 5.1522694134021E-4
colon cancer 1475 6.9729446459866E-4
pediatric high grade glioma 2712 0.00110364741181786
lung cancer 4473 0.00559921453524666
pancreatic carcinoma 567 0.00853072557870058
pancreatic cancer 2300 0.00853072557870064
atypical teratoid/rhabdoid tumor 1095 0.00865743432063346
Breast cancer 3099 0.0251539991072264

Expression

  Differential Expression (12)

Disease log2 FC p
hepatocellular carcinoma 1.500 0.000
pancreatic cancer 1.200 0.009
glioblastoma 1.300 0.000
sonic hedgehog group medulloblastoma 2.200 0.000
medulloblastoma, large-cell 2.300 0.000
lung cancer 1.800 0.006
colon cancer 1.200 0.001
Breast cancer 3.000 0.025
pediatric high grade glioma 1.300 0.001
atypical teratoid/rhabdoid tumor 1.100 0.009
pancreatic carcinoma 1.200 0.009
nasopharyngeal carcinoma 1.300 0.001

Synonym

Accession Q96EY4 Q0P6E4 Q0P6J1 Q9NUR7
Symbols C4orf43

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

AA Sequence

MPKAPKGKSAGREKKVIHPYSRKAAQITREAHKQEKKEKLKNEKALRLNLVGEKLQWFQNHLDPQKKRYS      1 - 70
KKDACELIERYLNRFSSELEQIELHNSIRDRQGRRHCSRETVIKQTMERERQQFEGYGLEIPDILNASNL     71 - 140
KTFREWDFDLKKLPNIKMRKICANDAIPKTCKRKTIITVDQDLGELELNDESSDSDEEMTAVA           141 - 203
//

Text Mined References (9)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.