Property Summary

NCBI Gene PubMed Count 56
Grant Count 20
R01 Count 17
Funding $1,653,898.39
PubMed Score 42.76
PubTator Score 39.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.213 0.002
ovarian cancer 1.200 0.008

Gene RIF (27)

PMID Text
26245905 The Role of the Phylogenetically Conserved Cochaperone Protein Droj2/DNAJA3 in NF-kappaB Signaling.
26055714 Tid1 increases autophagic flux by interacting with the Beclin 1-containing autophagy protein complex.
25904328 Impaired stoichiometry between mtHsp40 and mtHsp70 promotes Opa1L cleavage, leading to cristae opening, decreased OXPHOS, and triggering of mitochondrial fragmentation after reduction in their chaperone function.
24492964 TID1 prevents complex I aggregation and support the existence of a TID1-mediated stress response to ATP synthase inhibition
23698466 Tid1 acts as a tumor suppressor by inhibiting EGFR signaling through interaction with EGFR/HSP70/HSP90 and enhancing EGFR ubiquitinylation and degradation.
22692211 loss of hTid-1(S) expression in the basal layer of skin epidermis correlates with the enhanced HSP27 phosphorylation, keratinocyte hyperproliferation, and excess actin cytoskeleton organization in lesional psoriatic skin
22595283 Data show that elevated DnaJA3 induces dynamin-related protein 1 (Drp1)-depedendent mitochondrial fragmentation and decreased cell viability.
21710689 Tid1 and CHIP play pivotal roles in affecting the levels of ErbB2 protein, and that both are significant prognostic indicators of breast cancer patient survival.
21242965 findings denote hTid-1(S) as an essential regulatory component of MetR signaling
21106534 hTid1 negatively regulates the expression and transcriptional activity of STAT5b and suppresses the growth of hematopoietic cells transformed by an oncogenic form of STAT5b.
More...

AA Sequence

MAARCSTRWLLVVVGTPRLPAISGRGARPPREGVVGAWLSRKLSVPAFASSLTSCGPRALLTLRPGVSLT      1 - 70
GTKHNPFICTASFHTSAPLAKEDYYQILGVPRNASQKEIKKAYYQLAKKYHPDTNKDDPKAKEKFSQLAE     71 - 140
AYEVLSDEVKRKQYDAYGSAGFDPGASGSQHSYWKGGPTVDPEELFRKIFGEFSSSSFGDFQTVFDQPQE    141 - 210
YFMELTFNQAAKGVNKEFTVNIMDTCERCNGKGNEPGTKVQHCHYCGGSGMETINTGPFVMRSTCRRCGG    211 - 280
RGSIIISPCVVCRGAGQAKQKKRVMIPVPAGVEDGQTVRMPVGKREIFITFRVQKSPVFRRDGADIHSDL    281 - 350
FISIAQALLGGTARAQGLYETINVTIPPGTQTDQKIRMGGKGIPRINSYGYGDHYIHIKIRVPKRLTSRQ    351 - 420
QSLILSYAEDETDVEGTVNGVTLTSSGGSTMDSSAGSKARREAGEDEEGFLSKLKKMFTS              421 - 480
//

Text Mined References (60)

PMID Year Title
26245905 2015 The Role of the Phylogenetically Conserved Cochaperone Protein Droj2/DNAJA3 in NF-?B Signaling.
26055714 2015 Tid1, the Mammalian Homologue of Drosophila Tumor Suppressor Tid56, Mediates Macroautophagy by Interacting with Beclin1-containing Autophagy Protein Complex.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25904328 2015 Stoichiometric expression of mtHsp40 and mtHsp70 modulates mitochondrial morphology and cristae structure via Opa1L cleavage.
25416956 2014 A proteome-scale map of the human interactome network.
24492964 2014 Essential role of TID1 in maintaining mitochondrial membrane potential homogeneity and mitochondrial DNA integrity.
23698466 2013 Tid1-L inhibits EGFR signaling in lung adenocarcinoma by enhancing EGFR Ubiquitinylation and degradation.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22692211 2012 Absence of a human DnaJ protein hTid-1S correlates with aberrant actin cytoskeleton organization in lesional psoriatic skin.
More...