Property Summary

NCBI Gene PubMed Count 58
PubMed Score 43.32
PubTator Score 39.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
pancreatic ductal adenocarcinoma liver metastasis 1962 2.2e-03
ovarian cancer 8520 8.0e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer 1.200 8.0e-03
pancreatic ductal adenocarcinoma liver m... -1.213 2.2e-03

 GWAS Trait (1)

Gene RIF (27)

AA Sequence

MAARCSTRWLLVVVGTPRLPAISGRGARPPREGVVGAWLSRKLSVPAFASSLTSCGPRALLTLRPGVSLT      1 - 70
GTKHNPFICTASFHTSAPLAKEDYYQILGVPRNASQKEIKKAYYQLAKKYHPDTNKDDPKAKEKFSQLAE     71 - 140
AYEVLSDEVKRKQYDAYGSAGFDPGASGSQHSYWKGGPTVDPEELFRKIFGEFSSSSFGDFQTVFDQPQE    141 - 210
YFMELTFNQAAKGVNKEFTVNIMDTCERCNGKGNEPGTKVQHCHYCGGSGMETINTGPFVMRSTCRRCGG    211 - 280
RGSIIISPCVVCRGAGQAKQKKRVMIPVPAGVEDGQTVRMPVGKREIFITFRVQKSPVFRRDGADIHSDL    281 - 350
FISIAQALLGGTARAQGLYETINVTIPPGTQTDQKIRMGGKGIPRINSYGYGDHYIHIKIRVPKRLTSRQ    351 - 420
QSLILSYAEDETDVEGTVNGVTLTSSGGSTMDSSAGSKARREAGEDEEGFLSKLKKMFTS              421 - 480
//

Text Mined References (62)

PMID Year Title