Property Summary

NCBI Gene PubMed Count 13
PubMed Score 9.53
PubTator Score 6.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Atopic dermatitis 1.100 6.4e-04
atypical teratoid / rhabdoid tumor 1.900 4.9e-07
ductal carcinoma in situ 1.100 1.6e-03
ependymoma 1.600 1.6e-02
glioblastoma 1.100 1.0e-05
group 3 medulloblastoma 1.900 3.1e-05
invasive ductal carcinoma 1.200 2.2e-03
medulloblastoma, large-cell 1.500 7.7e-05
osteosarcoma -1.515 2.9e-03
ovarian cancer 1.800 3.3e-07
pediatric high grade glioma 1.300 9.4e-05
primitive neuroectodermal tumor 1.500 1.2e-03

Gene RIF (3)

AA Sequence

MATRAQPGPLSQAGSAGVAALATVGVASGPGPGRPGPLQDETLGVASVPSQWRAVQGIRWETKSCQTASI      1 - 70
ATASASAQARNHVDAQVQTEAPVPVSVQPPSQYDIPRLAAFLRRVEAMVIRELNKNWQSHAFDGFEVNWT     71 - 140
EQQQMVSCLYTLGYPPAQAQGLHVTSISWNSTGSVVACAYGRLDHGDWSTLKSFVCAWNLDRRDLRPQQP    141 - 210
SAVVEVPSAVLCLAFHPTQPSHVAGGLYSGEVLVWDLSRLEDPLLWRTGLTDDTHTDPVSQVVWLPEPGH    211 - 280
SHRFQVLSVATDGKVLLWQGIGVGQLQLTEGFALVMQQLPRSTKLKKHPRGETEVGATAVAFSSFDPRLF    281 - 350
ILGTEGGFPLKCSLAAGEAALTRMPSSVPLRAPAQFTFSPHGGPIYSVSCSPFHRNLFLSAGTDGHVHLY    351 - 420
SMLQAPPLTSLQLSLKYLFAVRWSPVRPLVFAAASGKGDVQLFDLQKSSQKPTVLIKQTQDESPVYCLEF    421 - 490
NSQQTQLLAAGDAQGTVKVWQLSTEFTEQGPREAEDLDCLAAEVAA                            491 - 536
//

Text Mined References (13)

PMID Year Title