Property Summary

NCBI Gene PubMed Count 10
Grant Count 4
Funding $927,478.33
PubMed Score 6.97
PubTator Score 6.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Synonym

Accession Q96EX3 Q5VXV4 Q9BV46
Symbols DIC5
FAP133
SRTD11
bA216B9.3

Gene

Gene RIF (3)

PMID Text
24183451 Mutations in WDR34 cause Jeune asphyxiating thoracic dystrophy. WDR34 is critical for ciliary functions essential to normal development and survival.
24183449 In patients with short-rib polydactyly syndrome type III, primary cilia in WDR34 mutant fibroblasts were significantly shorter than normal and had a bulbous tip.
19521662 Results suggest that WDR34 is a TAK1-associated inhibitor of the IL-1R/TLR3/TLR4-induced NF-kappaB activation pathway.

AA Sequence

MATRAQPGPLSQAGSAGVAALATVGVASGPGPGRPGPLQDETLGVASVPSQWRAVQGIRWETKSCQTASI      1 - 70
ATASASAQARNHVDAQVQTEAPVPVSVQPPSQYDIPRLAAFLRRVEAMVIRELNKNWQSHAFDGFEVNWT     71 - 140
EQQQMVSCLYTLGYPPAQAQGLHVTSISWNSTGSVVACAYGRLDHGDWSTLKSFVCAWNLDRRDLRPQQP    141 - 210
SAVVEVPSAVLCLAFHPTQPSHVAGGLYSGEVLVWDLSRLEDPLLWRTGLTDDTHTDPVSQVVWLPEPGH    211 - 280
SHRFQVLSVATDGKVLLWQGIGVGQLQLTEGFALVMQQLPRSTKLKKHPRGETEVGATAVAFSSFDPRLF    281 - 350
ILGTEGGFPLKCSLAAGEAALTRMPSSVPLRAPAQFTFSPHGGPIYSVSCSPFHRNLFLSAGTDGHVHLY    351 - 420
SMLQAPPLTSLQLSLKYLFAVRWSPVRPLVFAAASGKGDVQLFDLQKSSQKPTVLIKQTQDESPVYCLEF    421 - 490
NSQQTQLLAAGDAQGTVKVWQLSTEFTEQGPREAEDLDCLAAEVAA                            491 - 536
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24183451 2013 Mutations in the gene encoding IFT dynein complex component WDR34 cause Jeune asphyxiating thoracic dystrophy.
24183449 2013 WDR34 mutations that cause short-rib polydactyly syndrome type III/severe asphyxiating thoracic dysplasia reveal a role for the NF-?B pathway in cilia.
24144296 2013 Nine loci for ocular axial length identified through genome-wide association studies, including shared loci with refractive error.
23568457 2013 Genetic variants associated with disordered eating.
21953912 2011 A unified taxonomy for ciliary dyneins.
19521662 2009 WDR34 is a novel TAK1-associated suppressor of the IL-1R/TLR3/TLR4-induced NF-kappaB activation pathway.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.