Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.25
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma -1.300 9.6e-03
ependymoma -1.500 1.2e-02
oligodendroglioma -1.400 1.0e-02
pancreatic ductal adenocarcinoma liver m... -1.396 1.3e-02
primitive neuroectodermal tumor -1.100 7.0e-05

Synonym

Accession Q96EX1 D3DPR5 Q49AP7 Q52LP9 Q8NCB4
Symbols C1orf212

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MWPVFWTVVRTYAPYVTFPVAFVVGAVGYHLEWFIRGKDPQPVEEEKSISERREDRKLDELLGKDHTQVV      1 - 70
SLKDKLEFAPKAVLNRNRPEKN                                                     71 - 92
//

Text Mined References (5)

PMID Year Title