Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.25
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
primitive neuroectodermal tumor 3031 6.96928363468897E-5
astrocytic glioma 2241 0.00958069755928486
oligodendroglioma 2849 0.0104257035245256
ependymoma 2514 0.011579719659656
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0131060864869651

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma -1.300 0.010
ependymoma -1.500 0.012
oligodendroglioma -1.400 0.010
primitive neuroectodermal tumor -1.100 0.000
pancreatic ductal adenocarcinoma liver m... -1.396 0.013

Synonym

Accession Q96EX1 D3DPR5 Q49AP7 Q52LP9 Q8NCB4
Symbols C1orf212

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid

AA Sequence

MWPVFWTVVRTYAPYVTFPVAFVVGAVGYHLEWFIRGKDPQPVEEEKSISERREDRKLDELLGKDHTQVV      1 - 70
SLKDKLEFAPKAVLNRNRPEKN                                                     71 - 92
//

Text Mined References (5)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.