Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.25
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma -1.300 0.010
ependymoma -1.500 0.012
oligodendroglioma -1.400 0.010
primitive neuroectodermal tumor -1.100 0.000
pancreatic ductal adenocarcinoma liver m... -1.396 0.013

AA Sequence

MWPVFWTVVRTYAPYVTFPVAFVVGAVGYHLEWFIRGKDPQPVEEEKSISERREDRKLDELLGKDHTQVV      1 - 70
SLKDKLEFAPKAVLNRNRPEKN                                                     71 - 92
//

Text Mined References (5)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.