Property Summary

NCBI Gene PubMed Count 13
PubMed Score 3.21
PubTator Score 0.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
Pick disease 1893 3.70788473672129E-7
medulloblastoma, large-cell 6234 1.13942324978166E-6
ovarian cancer 8492 3.0005981330194E-6
glioblastoma 5572 2.01128440943065E-5
atypical teratoid / rhabdoid tumor 4369 2.15998404054229E-5
group 4 medulloblastoma 1875 3.37487826674546E-5
tuberculosis and treatment for 6 months 686 1.31867316078111E-4
osteosarcoma 7933 4.3555922180848E-4
progressive supranuclear palsy 674 0.00528043087807666
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.01126341375138
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0132580176781111
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0195954330287085
acute myeloid leukemia 785 0.0265523687125971
spina bifida 1064 0.030290597794364
Disease Target Count Z-score Confidence
Filariasis 21 4.239 2.1

Expression

Synonym

Accession Q96EV2 A4D244 B5MC24 Q52LF5 Q75LN9 Q75ML5 Q9NSV0
Symbols PRR8

Gene

  Ortholog (10)

 Compartment GO Term (1)

AA Sequence

MAAALGASGGAGAGDDDFDQFDKPGAERSWRRRAADEDWDSELEDDLLGEDLLSGKKNQSDLSDEELNDD      1 - 70
LLQSDNEDEENFSSQGVTISLNATSGMVTSFELSDNTNDQSGEQESEYEQEQGEDELVYHKSDGSELYTQ     71 - 140
EYPEEGQYEGHEAELTEDQIEYVEEPEEEQLYTDEVLDIEINEPLDEFTGGMETLELQKDIKEESDEEEE    141 - 210
DDEESGRLRFKTERKEGTIIRLSDVTRERRNIPETLELSAEAKAALLEFEERERQHKQGRYSSRRGGRRG    211 - 280
GPLMCRGVGDQRRESTERGRMKDHRPALLPTQPPVVPQAPPPPPPPPQQQPIRSLFQPQPLQPLLPVQHP    281 - 350
HHPSPPQGMHMPPQLETPRMMMTPPPVTPQQPKNIHINPHFKGTVVTPVQVPLLPVPSQPRPAVGPQRFP    351 - 420
GPPEFPQHTPGPVPNSFSQPPRLPLQDQWRAPPPPQDRDPFFLGVSGEPRFPSHLFLEQRSPPPPPPPPT    421 - 490
LLNSSHPVPTQSPLPFTQPGPAFNQQGQQPVFPRERPVRPALQPPGPVGILHFSQPGSATTRPFIPPRQP    491 - 560
FLPGPGQPFLPTHTQPNLQGPLHPPLPPPHQPQPQQPQQQPPPQHQPPHQPPHQPPPQHQPPPQHPPQHP    561 - 630
PQHQHHHHHHHLSVPPPPLMPMSQPQFRPHVQTAQPQASSSRMQCPQRQGLRHNTTSQNVSKRPMQQMQP    631 - 700
TAPRNSNLRELPIAPSHVIEMSSSRCSATPSAQVKPIVSASPPSRAVAGSRSSQGKTEVKVKPASPVAQP    701 - 770
KEEAKTETEFPDEDEETRLYRLKIEEQKRLREEILKQKELRRQQQAGARKKELLERLAQQQQQLYAPPPP    771 - 840
AEQEEQALSPSPTNGNPLLPFPGAQVRQNVKNRLLVKNQDVSISNVQPKTSNFVPSSANMQYQGQQMKAL    841 - 910
KHLRQTRTVPQSQTQPLHKVLPIKPADVEEPAVPQTPRVASIQGRPQDTKPGVKRTVTHRTNSGGGDGPH    911 - 980
ISSKVRVIKLSGGGGESDGFFHPEGQPQRLPQPPEVGPQPARKVTLTRGGLQQPPHLPAGPHAHSPVPPG    981 - 1050
IKSIQGIHPAKKAIMHGRGRGVAGPMGRGRLMPNKQNLRVVECKPQPCVVSVEGLSSSTTDAQLKSLLMS   1051 - 1120
VGPIQSLQMLPQQRKAIAKFKEPAHALAFQQKFHRHMIDLSHINVALIVE                       1121 - 1170
//

Text Mined References (24)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...