Property Summary

NCBI Gene PubMed Count 38
PubMed Score 115.08
PubTator Score 56.16

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
Astrocytoma, Pilocytic 1.200 1.9e-07
hepatocellular carcinoma 1.100 8.2e-05
ovarian cancer -1.100 3.8e-04
pancreatic cancer 1.100 1.5e-02
pancreatic carcinoma 1.100 1.5e-02
pituitary cancer -1.200 8.5e-07

Synonym

Accession Q96EU7 A8K246 Q8WWS3 Q9NZX1
Symbols TNPS
COSMC
MST143
C1GALT2
HSPC067
C38H2-L1

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (31)

AA Sequence

MLSESSSFLKGVMLGSIFCALITMLGHIRIGHGNRMHHHEHHHLQAPNKEDILKISEDERMELSKSFRVY      1 - 70
CIILVKPKDVSLWAAVKETWTKHCDKAEFFSSENVKVFESINMDTNDMWLMMRKAYKYAFDKYRDQYNWF     71 - 140
FLARPTTFAIIENLKYFLLKKDPSQPFYLGHTIKSGDLEYVGMEGGIVLSVESMKRLNSLLNIPEKCPEQ    141 - 210
GGMIWKISEDKQLAVCLKYAGVFAENAEDADGKDVFNTKSVGLSIKEAMTYHPNQVVEGCCSDMAVTFNG    211 - 280
LTPNQMHVMMYGVYRLRAFGHIFNDALVFLPPNGSDND                                    281 - 318
//

Text Mined References (42)

PMID Year Title