Property Summary

NCBI Gene PubMed Count 33
Grant Count 36
R01 Count 19
Funding $2,502,377.46
PubMed Score 102.49
PubTator Score 56.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
hepatocellular carcinoma 1.100 0.000
pancreatic cancer 1.100 0.015
pilocytic astrocytoma 1.200 0.000
pancreatic carcinoma 1.100 0.015
ovarian cancer 1.500 0.001
pituitary cancer -1.200 0.000

Gene RIF (26)

PMID Text
26545495 Data suggest that patients with IgA nephropathy exhibit higher microRNA-374b in B cells compared to controls; microRNA-374b appears to target PTEN (phosphatase and tensin homolog) and Cosmc (C1GALT1 specific chaperone 1) proteins.
26063800 Cosmc and T-synthase are transcriptionally regulated at a basal level by the specificity protein/Kruppel-like transcription factor family of members.
26045765 These results indicate that Tn antigens expression and T-synthase inactivity in HT-29-Tn+ cells can be related to the absence of the Cosmc gene coding sequence in Cosmc active alleles
26021314 the impact of COSMC mediated Tn antigen expression in two human pancreatic ductal adenocarcinoma cell lines on cellular oncogenic properties, were investigated.
25647400 hypermethylation of Cosmc promoter region could be a key mechanism for the reduction of Cosmc mRNA expression in IgAN lymphocytes with associated increase in aberrantly glycosylated IgA1
24616093 CBRT is a unique recognition motif for Cosmc to promote its regulation and formation of active T-synthase and represents the first sequence-specific chaperone recognition system in the ER/Golgi required for normal protein O-glycosylation
24462875 Data indicate that cytotoxin associated gene A protein (CagA) promoted the underglycosylation of IgA1, which at least partly attributed to the downregulation of beta1,3-galactosyltransferase (C1GALT1) and its chaperone Cosmc.
23424651 COSMC is a novel regulator for VEGFR2 signaling in endothelial cells and dysregulation of COSMC expression may contribute to the pathogenesis of hemangioma
23390052 overexpression of Cosmc is associated with colorectal cancer.
22416136 Results show that soluble Cosmc directly interacts in a specific manner with denatured, but not native, T-synthase to form a noncovalent and reversible complex that results in the acquisition of T-synthase catalytic activity.
More...

AA Sequence

MLSESSSFLKGVMLGSIFCALITMLGHIRIGHGNRMHHHEHHHLQAPNKEDILKISEDERMELSKSFRVY      1 - 70
CIILVKPKDVSLWAAVKETWTKHCDKAEFFSSENVKVFESINMDTNDMWLMMRKAYKYAFDKYRDQYNWF     71 - 140
FLARPTTFAIIENLKYFLLKKDPSQPFYLGHTIKSGDLEYVGMEGGIVLSVESMKRLNSLLNIPEKCPEQ    141 - 210
GGMIWKISEDKQLAVCLKYAGVFAENAEDADGKDVFNTKSVGLSIKEAMTYHPNQVVEGCCSDMAVTFNG    211 - 280
LTPNQMHVMMYGVYRLRAFGHIFNDALVFLPPNGSDND                                    281 - 318
//

Text Mined References (37)

PMID Year Title
26545495 2015 Increased miR-374b promotes cell proliferation and the production of aberrant glycosylated IgA1 in B cells of IgA nephropathy.
26063800 2015 Promoters of Human Cosmc and T-synthase Genes Are Similar in Structure, Yet Different in Epigenetic Regulation.
26045765 2015 Aberrant Cosmc genes result in Tn antigen expression in human colorectal carcinoma cell line HT-29.
26021314 2015 COSMC knockdown mediated aberrant O-glycosylation promotes oncogenic properties in pancreatic cancer.
25647400 2015 DNA methylation in Cosmc promoter region and aberrantly glycosylated IgA1 associated with pediatric IgA nephropathy.
24616093 2014 Identification of a novel protein binding motif within the T-synthase for the molecular chaperone Cosmc.
24462875 2014 CagA, a major virulence factor of Helicobacter pylori, promotes the production and underglycosylation of IgA1 in DAKIKI cells.
23424651 2013 COSMC is overexpressed in proliferating infantile hemangioma and enhances endothelial cell growth via VEGFR2.
23390052 2014 The molecular chaperone Cosmc enhances malignant behaviors of colon cancer cells via activation of Akt and ERK.
23035125 2012 Epigenetic silencing of the chaperone Cosmc in human leukocytes expressing tn antigen.
More...