Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.83
PubTator Score 1.63

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.500 0.000
diabetes mellitus -1.500 0.001
ovarian cancer 2.400 0.000

Synonym

Accession Q96EU6 Q9BRF6 Q9P0C8
Symbols C6orf153
dJ20C7.4

Gene

 GO Function (1)

Gene RIF (1)

PMID Text
20038530 studied the orthologue of Rrp36p in HeLa cells, and showed that the function of this protein in early cleavages of the pre-rRNA has been conserved through evolution in eukaryotes

AA Sequence

MPGANYRAGAGAGAGARRPRGARDREEDGGGLEPAAVARDLLRGTSNMSFEELLELQSQVGTKTYKQLVA      1 - 70
GNSPKKQASRPPIQNACVADKHRPLEMSAKIRVPFLRQVVPISKKVARDPRFDDLSGEYNPEVFDKTYQF     71 - 140
LNDIRAKEKELVKKQLKKHLSGEEHEKLQQLLQRMEQQEMAQQERKQQQELHLALKQERRAQAQQGHRPY    141 - 210
FLKKSEQRQLALAEKFKELKRSKKLENFLSRKRRRNAGKDRRHLPLSKE                         211 - 259
//

Text Mined References (13)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20038530 2010 Evolutionarily conserved function of RRP36 in early cleavages of the pre-rRNA and production of the 40S ribosomal subunit.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15983380 2005 Complex humoral immune response against a benign tumor: frequent antibody response against specific antigens as diagnostic targets.
15635413 2005 Nucleolar proteome dynamics.
More...