Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.83
PubTator Score 1.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 1.1e-06
group 3 medulloblastoma 4104 2.6e-05
diabetes mellitus 1728 1.0e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Meningioma 41 3.259 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
diabetes mellitus -1.500 1.0e-03
group 3 medulloblastoma 1.500 2.6e-05
ovarian cancer 2.400 1.1e-06

 GO Function (1)

Gene RIF (1)

AA Sequence

MPGANYRAGAGAGAGARRPRGARDREEDGGGLEPAAVARDLLRGTSNMSFEELLELQSQVGTKTYKQLVA      1 - 70
GNSPKKQASRPPIQNACVADKHRPLEMSAKIRVPFLRQVVPISKKVARDPRFDDLSGEYNPEVFDKTYQF     71 - 140
LNDIRAKEKELVKKQLKKHLSGEEHEKLQQLLQRMEQQEMAQQERKQQQELHLALKQERRAQAQQGHRPY    141 - 210
FLKKSEQRQLALAEKFKELKRSKKLENFLSRKRRRNAGKDRRHLPLSKE                         211 - 259
//

Text Mined References (13)

PMID Year Title