Property Summary

NCBI Gene PubMed Count 15
PubMed Score 555.08
PubTator Score 6.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 9.5474191519773E-7
malignant mesothelioma 3163 4.83304688227484E-6
group 3 medulloblastoma 2254 0.00414965670882768
Disease Target Count Z-score Confidence
Cancer 2346 3.132 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
osteosarcoma -1.644 0.000
group 3 medulloblastoma 1.300 0.004

Synonym

Accession Q96ES7 Q96MF5
Symbols STAF36
TDRD29
CCDC101

Gene

PDB

3LX7   3ME9   3MEA   3MET   3MEU   3MEV   3MEW   5C0M  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG

 GO Function (1)

Gene RIF (1)

PMID Text
23894581 Results suggest that the H3K4me3-binding protein SGF29 plays a central and dual role in the ER stress response.

AA Sequence

MALVSADSRIAELLTELHQLIKQTQEERSRSEHNLVNIQKTHERMQTENKISPYYRTKLRGLYTTAKADA      1 - 70
EAECNILRKALDKIAEIKSLLEERRIAAKIAGLYNDSEPPRKTMRRGVLMTLLQQSAMTLPLWIGKPGDK     71 - 140
PPPLCGAIPASGDYVARPGDKVAARVKAVDGDEQWILAEVVSYSHATNKYEVDDIDEEGKERHTLSRRRV    141 - 210
IPLPQWKANPETDPEALFQKEQLVLALYPQTTCFYRALIHAPPQRPQDDYSVLFEDTSYADGYSPPLNVA    211 - 280
QRYVVACKEPKKK                                                             281 - 293
//

Text Mined References (18)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25416956 2014 A proteome-scale map of the human interactome network.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
23894581 2013 A dual role for SAGA-associated factor 29 (SGF29) in ER stress survival by coordination of both histone H3 acetylation and histone H3 lysine-4 trimethylation.
21685874 2011 Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation.
21269460 2011 Initial characterization of the human central proteome.
20850016 2010 Quantitative interaction proteomics and genome-wide profiling of epigenetic histone marks and their readers.
19915574 2009 Common variants at five new loci associated with early-onset inflammatory bowel disease.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
More...