Property Summary

NCBI Gene PubMed Count 16
PubMed Score 590.13
PubTator Score 6.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Chemical and Drug Induced Liver Injury 195 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 9.5e-07
malignant mesothelioma 3232 4.8e-06
group 3 medulloblastoma 4104 4.1e-03
Disease Target Count Z-score Confidence
Cancer 2499 3.148 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.300 4.1e-03
malignant mesothelioma 1.100 4.8e-06
osteosarcoma -1.644 9.5e-07

Synonym

Accession Q96ES7 Q96MF5
Symbols STAF36
TDRD29
CCDC101

Gene

PDB

3LX7   3ME9   3MEA   3MET   3MEU   3MEV   3MEW   5C0M  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

Gene RIF (1)

AA Sequence

MALVSADSRIAELLTELHQLIKQTQEERSRSEHNLVNIQKTHERMQTENKISPYYRTKLRGLYTTAKADA      1 - 70
EAECNILRKALDKIAEIKSLLEERRIAAKIAGLYNDSEPPRKTMRRGVLMTLLQQSAMTLPLWIGKPGDK     71 - 140
PPPLCGAIPASGDYVARPGDKVAARVKAVDGDEQWILAEVVSYSHATNKYEVDDIDEEGKERHTLSRRRV    141 - 210
IPLPQWKANPETDPEALFQKEQLVLALYPQTTCFYRALIHAPPQRPQDDYSVLFEDTSYADGYSPPLNVA    211 - 280
QRYVVACKEPKKK                                                             281 - 293
//

Text Mined References (20)

PMID Year Title