Property Summary

NCBI Gene PubMed Count 15
Grant Count 29
R01 Count 23
Funding $4,723,401.5
PubMed Score 555.08
PubTator Score 6.36

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
osteosarcoma -1.644 0.000
group 3 medulloblastoma 1.300 0.004

 GO Function (1)

Gene RIF (1)

PMID Text
23894581 Results suggest that the H3K4me3-binding protein SGF29 plays a central and dual role in the ER stress response.

AA Sequence

MALVSADSRIAELLTELHQLIKQTQEERSRSEHNLVNIQKTHERMQTENKISPYYRTKLRGLYTTAKADA      1 - 70
EAECNILRKALDKIAEIKSLLEERRIAAKIAGLYNDSEPPRKTMRRGVLMTLLQQSAMTLPLWIGKPGDK     71 - 140
PPPLCGAIPASGDYVARPGDKVAARVKAVDGDEQWILAEVVSYSHATNKYEVDDIDEEGKERHTLSRRRV    141 - 210
IPLPQWKANPETDPEALFQKEQLVLALYPQTTCFYRALIHAPPQRPQDDYSVLFEDTSYADGYSPPLNVA    211 - 280
QRYVVACKEPKKK                                                             281 - 293
//

Text Mined References (18)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25416956 2014 A proteome-scale map of the human interactome network.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
23894581 2013 A dual role for SAGA-associated factor 29 (SGF29) in ER stress survival by coordination of both histone H3 acetylation and histone H3 lysine-4 trimethylation.
21685874 2011 Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation.
21269460 2011 Initial characterization of the human central proteome.
20850016 2010 Quantitative interaction proteomics and genome-wide profiling of epigenetic histone marks and their readers.
19915574 2009 Common variants at five new loci associated with early-onset inflammatory bowel disease.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
More...