Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 2.2e-04
invasive ductal carcinoma 2951 3.1e-02

Expression

  Differential Expression (2)

Disease log2 FC p
invasive ductal carcinoma 1.100 3.1e-02
ovarian cancer 1.300 2.2e-04

AA Sequence

MRGKLLPLAGLYLVQGLPYGLQSGLLPVLLRAGGLSLTRVGLAKVLYAPWLLKLAWAPLVDAQGSARAWV      1 - 70
TRSTAGLGLVCGLLAGLPPPGAGQAGLPAAVAGLLLLLNLGAAMQDVALDALAVQLLEPAELGPGNTVQV     71 - 140
VAYKLGAALAGGALLALLPTFSWPQLFLLLAATYWLAAALAWAAPALRRLPQQPPSEQRPHTAHLLRDVL    141 - 210
AVPGTVWTAGFVLTYKLGEQGASSLFPLLLLDHGVSAPELGLWNGVGAVVCSIAGSSLGGTLLAKHWKLL    211 - 280
PLLRSVLRFRLGGLACQTALVFHLDTLGASMDAGTILRGSALLSLCLQHFLGGLVTTVTFTGMMRCSQLA    281 - 350
PRALQATHYSLLATLELLGKLLLGTLAGGLADGLGPHPCFLLLLILSAFPVLYLDLAPSTFL            351 - 412
//

Text Mined References (4)

PMID Year Title