Property Summary

NCBI Gene PubMed Count 20
PubMed Score 7.89
PubTator Score 10.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
TENORIO SYNDROME 1 0.0 0.0

Expression

  Differential Expression (13)

Disease log2 FC p
Astrocytoma, Pilocytic 1.400 3.5e-03
Breast cancer -2.400 4.9e-02
cystic fibrosis and chronic rhinosinusit... 1.132 3.6e-03
ductal carcinoma in situ -1.100 6.0e-03
group 4 medulloblastoma -1.100 9.9e-03
intraductal papillary-mucinous adenoma (... 1.100 4.7e-02
invasive ductal carcinoma -1.300 2.9e-02
lung cancer -1.700 4.9e-03
non-small cell lung cancer -1.480 1.7e-16
osteosarcoma -2.338 3.2e-03
ovarian cancer -1.500 2.3e-05
primary Sjogren syndrome 1.200 1.0e-03
ulcerative colitis -1.500 1.8e-04

 GWAS Trait (1)

Gene RIF (10)

AA Sequence

MGSVLSTDSGKSAPASATARALERRRDPELPVTSFDCAVCLEVLHQPVRTRCGHVFCRSCIATSLKNNKW      1 - 70
TCPYCRAYLPSEGVPATDVAKRMKSEYKNCAECDTLVCLSEMRAHIRTCQKYIDKYGPLQELEETAARCV     71 - 140
CPFCQRELYEDSLLDHCITHHRSERRPVFCPLCRLIPDENPSSFSGSLIRHLQVSHTLFYDDFIDFNIIE    141 - 210
EALIRRVLDRSLLEYVNHSNTT                                                    211 - 232
//

Text Mined References (20)

PMID Year Title