Property Summary

NCBI Gene PubMed Count 14
Grant Count 1
Funding $42,412.5
PubMed Score 6.63
PubTator Score 10.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Synonym

Accession Q96EQ8 Q9NX39
Symbols TNORS
TRAC1
TRAC-1

Gene

PANTHER Protein Class (2)

 Grant Application (1)

PDB

5DKA  

Gene RIF (9)

PMID Text
26202983 Results indicate that the nucleotide sequence in the 3' untranslated region (3' UTR) of ring finger protein 125 (RNF125) is a potential microRNA miR-15b targeting site.
26027934 we identified the downregulation of the ubiquitin ligase RNF125 in BRAFi-resistant melanomas
25196541 studies of the RNF125 pathway point to upregulation of RIG-I-IPS1-MDA5 and/or disruption of the PI3K-AKT and interferon signaling pathways as the putative final effectors
24131985 In controls, RNF125 is the highest expressed gene, whereas in HIV infection progressors, RIG-I is either the highest expressed gene or is expressed similarly to RNF125 and TRIM25.
23772026 study reports human bocavirus VP2 modulates IFN pathway by targeting the ring finger protein 125, a negative regulator of type I IFN signaling, which conjugates Lys(48)-linked ubiquitination to retinoic acid-inducible gene-I and leads to the proteasome-dependent degradation of RIG-I
22632162 HIV-1 Tat 47-59 peptide upregulates gene expression of ring finger protein 125, E3 ubiquitin protein ligase (RNF125) in U-937 macrophages
17990982 TRAC-1 associates with membranes and is excluded from the nucleus through myristoylation
17643463 These results suggest that RNF125/TRAC-1 could function to recruit host factor(s) controlling HIV-1 transcription to the ubiquitin-proteasome pathway.
17643463 HIV-1 Tat 47-59 peptide upregulates gene expression of ring finger protein 125, E3 ubiquitin protein ligase (RNF125) in U-937 macrophages

AA Sequence

MGSVLSTDSGKSAPASATARALERRRDPELPVTSFDCAVCLEVLHQPVRTRCGHVFCRSCIATSLKNNKW      1 - 70
TCPYCRAYLPSEGVPATDVAKRMKSEYKNCAECDTLVCLSEMRAHIRTCQKYIDKYGPLQELEETAARCV     71 - 140
CPFCQRELYEDSLLDHCITHHRSERRPVFCPLCRLIPDENPSSFSGSLIRHLQVSHTLFYDDFIDFNIIE    141 - 210
EALIRRVLDRSLLEYVNHSNTT                                                    211 - 232
//

Text Mined References (14)

PMID Year Title
26202983 2015 MicroRNA-15b Modulates Japanese Encephalitis Virus-Mediated Inflammation via Targeting RNF125.
26027934 2015 Downregulation of the Ubiquitin Ligase RNF125 Underlies Resistance of Melanoma Cells to BRAF Inhibitors via JAK1 Deregulation.
25196541 2014 A new overgrowth syndrome is due to mutations in RNF125.
24131985 2013 Expression levels of the innate response gene RIG-I and its regulators RNF125 and TRIM25 in HIV-1-infected adult and pediatric individuals.
23772026 2013 Human bocavirus VP2 upregulates IFN-? pathway by inhibiting ring finger protein 125-mediated ubiquitination of retinoic acid-inducible gene-I.
17990982 2008 T-cell regulator RNF125/TRAC-1 belongs to a novel family of ubiquitin ligases with zinc fingers and a ubiquitin-binding domain.
17643463 2007 The RING finger ubiquitin ligase RNF125/TRAC-1 down-modulates HIV-1 replication in primary human peripheral blood mononuclear cells.
15843525 2005 A novel E3 ubiquitin ligase TRAC-1 positively regulates T cell activation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...