Property Summary

NCBI Gene PubMed Count 7
PubMed Score 9.42
PubTator Score 4.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma -2.100 0.006
ependymoma -3.000 0.007
oligodendroglioma -1.800 0.024
glioblastoma -2.500 0.000
osteosarcoma -1.073 0.001
medulloblastoma -1.900 0.000
atypical teratoid / rhabdoid tumor -3.100 0.000
medulloblastoma, large-cell -3.200 0.000
primitive neuroectodermal tumor -1.900 0.000
intraductal papillary-mucinous carcinoma... -1.400 0.006
sarcoidosis 1.500 0.010
adult high grade glioma -2.200 0.000
pilocytic astrocytoma -1.400 0.001
primary Sjogren syndrome 1.500 0.000
acute myeloid leukemia 1.400 0.003
ulcerative colitis 1.600 0.000
ovarian cancer -1.700 0.000

Synonym

Accession Q96EQ0
Symbols SGT2

Gene

PANTHER Protein Class (1)

 Compartment GO Term (1)

AA Sequence

MSSIKHLVYAVIRFLREQSQMDTYTSDEQESLEVAIQCLETVFKISPEDTHLAVSQPLTEMFTSSFCKND      1 - 70
VLPLSNSVPEDVGKADQLKDEGNNHMKEENYAAAVDCYTQAIELDPNNAVYYCNRAAAQSKLGHYTDAIK     71 - 140
DCEKAIAIDSKYSKAYGRMGLALTALNKFEEAVTSYQKALDLDPENDSYKSNLKIAEQKLREVSSPTGTG    141 - 210
LSFDMASLINNPAFISMAASLMQNPQVQQLMSGMMTNAIGGPAAGVGGLTDLSSLIQAGQQFAQQIQQQN    211 - 280
PELIEQLRNHIRSRSFSSSAEEHS                                                  281 - 304
//

Text Mined References (11)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...