Property Summary

NCBI Gene PubMed Count 7
PubMed Score 9.42
PubTator Score 4.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
medulloblastoma 1524 2.75798018091692E-8
atypical teratoid / rhabdoid tumor 4369 1.84990468437792E-7
medulloblastoma, large-cell 6234 1.22151558413508E-6
ovarian cancer 8492 1.68794791857906E-6
glioblastoma 5572 2.17301461149953E-6
primitive neuroectodermal tumor 3031 1.7670205907307E-5
ulcerative colitis 2087 9.78067941801293E-5
adult high grade glioma 2148 1.83662487247571E-4
primary Sjogren syndrome 789 2.00095888913133E-4
pilocytic astrocytoma 3086 7.20092412598218E-4
osteosarcoma 7933 0.00120365866923233
acute myeloid leukemia 785 0.00266455085217416
astrocytic glioma 2241 0.00563474135692339
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00569365060324688
ependymoma 2514 0.00681432692648227
sarcoidosis 368 0.0104221540758616
oligodendroglioma 2849 0.0238266415165854

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma -2.100 0.006
ependymoma -3.000 0.007
oligodendroglioma -1.800 0.024
glioblastoma -2.500 0.000
osteosarcoma -1.073 0.001
medulloblastoma -1.900 0.000
atypical teratoid / rhabdoid tumor -3.100 0.000
medulloblastoma, large-cell -3.200 0.000
primitive neuroectodermal tumor -1.900 0.000
intraductal papillary-mucinous carcinoma... -1.400 0.006
sarcoidosis 1.500 0.010
adult high grade glioma -2.200 0.000
pilocytic astrocytoma -1.400 0.001
primary Sjogren syndrome 1.500 0.000
acute myeloid leukemia 1.400 0.003
ulcerative colitis 1.600 0.000
ovarian cancer -1.700 0.000

Synonym

Accession Q96EQ0
Symbols SGT2

Gene

PANTHER Protein Class (1)

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA Inparanoid
S.cerevisiae OMA Inparanoid

 Compartment GO Term (1)

AA Sequence

MSSIKHLVYAVIRFLREQSQMDTYTSDEQESLEVAIQCLETVFKISPEDTHLAVSQPLTEMFTSSFCKND      1 - 70
VLPLSNSVPEDVGKADQLKDEGNNHMKEENYAAAVDCYTQAIELDPNNAVYYCNRAAAQSKLGHYTDAIK     71 - 140
DCEKAIAIDSKYSKAYGRMGLALTALNKFEEAVTSYQKALDLDPENDSYKSNLKIAEQKLREVSSPTGTG    141 - 210
LSFDMASLINNPAFISMAASLMQNPQVQQLMSGMMTNAIGGPAAGVGGLTDLSSLIQAGQQFAQQIQQQN    211 - 280
PELIEQLRNHIRSRSFSSSAEEHS                                                  281 - 304
//

Text Mined References (11)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...