Property Summary

NCBI Gene PubMed Count 8
PubMed Score 10.98
PubTator Score 259.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
cystic fibrosis 1696 1.8e-06
pituitary cancer 1972 1.0e-05
osteosarcoma 7950 1.6e-04
group 4 medulloblastoma 1855 1.7e-02
glioblastoma 5792 3.6e-02

Expression

  Differential Expression (5)

Disease log2 FC p
cystic fibrosis 3.088 1.8e-06
glioblastoma 1.200 3.6e-02
group 4 medulloblastoma 1.900 1.7e-02
osteosarcoma -2.488 1.6e-04
pituitary cancer 4.200 1.0e-05

Gene RIF (4)

AA Sequence

MDGNDNVTLLFAPLLRDNYTLAPNASSLGPGTDLALAPASSAGPGPGLSLGPGPSFGFSPGPTPTPEPTT      1 - 70
SGLAGGAASHGPSPFPRPWAPHALPFWDTPLNHGLNVFVGAALCITMLGLGCTVDVNHFGAHVRRPVGAL     71 - 140
LAALCQFGLLPLLAFLLALAFKLDEVAAVAVLLCGCCPGGNLSNLMSLLVDGDMNLSIIMTISSTLLALV    141 - 210
LMPLCLWIYSWAWINTPIVQLLPLGTVTLTLCSTLIPIGLGVFIRYKYSRVADYIVKVSLWSLLVTLVVL    211 - 280
FIMTGTMLGPELLASIPAAVYVIAIFMPLAGYASGYGLATLFHLPPNCKRTVCLETGSQNVQLCTAILKL    281 - 350
AFPPQFIGSMYMFPLLYALFQSAEAGIFVLIYKMYGSEMLHKRDPLDEDEDTDISYKKLKEEEMADTSYG    351 - 420
TVKAENIIMMETAQTSL                                                         421 - 437
//

Text Mined References (9)

PMID Year Title