Property Summary

NCBI Gene PubMed Count 8
Grant Count 12
R01 Count 4
Funding $4,219,410
PubMed Score 10.05
PubTator Score 259.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -2.488 0.000
cystic fibrosis 3.088 0.000
glioblastoma 1.200 0.036
group 4 medulloblastoma 1.900 0.017
pituitary cancer 4.200 0.000

Gene RIF (4)

PMID Text
26084360 SLC10A4 failed to show transport activity for a series of neurotransmitters and neuromodulators, indicating that SLC10A4 does not seem to represent a typical neurotransmitter transporter such as DAT, SERT, CHT1 or VMAT2
23948907 Depletion of SLC10A4 is observed in the brain with increased severity of Alzheimer's disease-related neuronal degeneration.
23589386 The extracellular N-terminus of SLC10A4 was predicted to be relatively longer at the amino acid level than those of SLC10A1, SLC10A2 and SLC10A6. We examined the relationship between the N-terminus and transport activity of SLC10A4.
17106928 Northern analysis revealed that SLC10A4 mRNA is ubiquitously expressed in human tissues with the highest levels of mRNA expression in brain, placenta, and liver.

AA Sequence

MDGNDNVTLLFAPLLRDNYTLAPNASSLGPGTDLALAPASSAGPGPGLSLGPGPSFGFSPGPTPTPEPTT      1 - 70
SGLAGGAASHGPSPFPRPWAPHALPFWDTPLNHGLNVFVGAALCITMLGLGCTVDVNHFGAHVRRPVGAL     71 - 140
LAALCQFGLLPLLAFLLALAFKLDEVAAVAVLLCGCCPGGNLSNLMSLLVDGDMNLSIIMTISSTLLALV    141 - 210
LMPLCLWIYSWAWINTPIVQLLPLGTVTLTLCSTLIPIGLGVFIRYKYSRVADYIVKVSLWSLLVTLVVL    211 - 280
FIMTGTMLGPELLASIPAAVYVIAIFMPLAGYASGYGLATLFHLPPNCKRTVCLETGSQNVQLCTAILKL    281 - 350
AFPPQFIGSMYMFPLLYALFQSAEAGIFVLIYKMYGSEMLHKRDPLDEDEDTDISYKKLKEEEMADTSYG    351 - 420
TVKAENIIMMETAQTSL                                                         421 - 437
//

Text Mined References (9)

PMID Year Title
26084360 2015 Expression, sorting and transport studies for the orphan carrier SLC10A4 in neuronal and non-neuronal cell lines and in Xenopus laevis oocytes.
23948907 2013 Distribution of SLC10A4, a synaptic vesicle protein in the human brain, and the association of this protein with Alzheimer's disease-related neuronal degeneration.
23589386 2013 SLC10A4 is a protease-activated transporter that transports bile acids.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
18355966 2008 Cloning and molecular characterization of the orphan carrier protein Slc10a4: expression in cholinergic neurons of the rat central nervous system.
17106928 2006 Cloning and expression of SLC10A4, a putative organic anion transport protein.
16541252 2006 The solute carrier family SLC10: more than a family of bile acid transporters regarding function and phylogenetic relationships.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.