Property Summary

NCBI Gene PubMed Count 21
PubMed Score 24.09
PubTator Score 13.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -2.554 8.8e-07
acute quadriplegic myopathy 1.054 3.4e-07
breast carcinoma 1.600 3.0e-03
sonic hedgehog group medulloblastoma 1.100 1.1e-05
ovarian cancer 1.600 1.4e-04

Gene RIF (10)

PMID Text
24452013 The splicing activator DAZAP1 integrates splicing control into MEK/Erk-regulated cell proliferation and migration.
23111326 this study reports the mapping of a 42-amino acid segment (N42) at the N-terminus of DAZAP1 that is both necessary and sufficient for its transcription-dependent nuclear localization.
22174317 HIV-1 Rev interacting protein, DAZ-associated protein 1 (DAZAP1), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa. The interaction of Rev with DAZAP1 is increased by RRE
21858080 Data show that hnRNPA1/A2, HuR and DAZAP1 splicing factors and DHX36 RNA helicase bind to the ISE, with hnRNPA1 acting negatively and DAZAP1 positively on splicing selection
21576381 DAZAP1 can regulate mRNA translation.
19285026 The results suggest that DAZAP1 is a component of complexes that are crucial for the degradation and silencing of mRNA.
18391021 The binding of the splicing factors hnRNPA1/A2 and DAZAP1 is the primary determinant of T6 BRCA1 exon 18 exclusion.
16848763 DAZ cannot bind simultaneously to DAZAP1 and poly(A)-binding protein (PABP), and suggest that the phosphorylation-induced dissociation of DAZ and DAZAP1 may allow the former to stimulate translation by interacting with PABP.
16209998 This study shows expression patterns of DAZAP1 in human corpus luteum cells and demonstrates the in vivo interaction of DAZ-like protein (DAZL) with DAZAP1.
15744350 data suggest that MEF2D/DAZAP1 and/or DAZAP1/MEF2D contribute to leukemogenesis by altering signaling pathways normally regulated by wild-type MEF2D and DAZAP1

AA Sequence

MNNSGADEIGKLFVGGLDWSTTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTVLAS      1 - 70
RPHTLDGRNIDPKPCTPRGMQPERTRPKEGWQKGPRSDNSKSNKIFVGGIPHNCGETELREYFKKFGVVT     71 - 140
EVVMIYDAEKQRPRGFGFITFEDEQSVDQAVNMHFHDIMGKKVEVKRAEPRDSKSQAPGQPGASQWGSRV    141 - 210
VPNAANGWAGQPPPTWQQGYGPQGMWVPAGQAIGGYGPPPAGRGAPPPPPPFTSYIVSTPPGGFPPPQGF    211 - 280
PQGYGAPPQFSFGYGPPPPPPDQFAPPGVPPPPATPGAAPLAFPPPPSQAAPDMSKPPTAQPDFPYGQYA    281 - 350
GYGQDLSGFGQGFSDPSQQPPSYGGPSVPGSGGPPAGGSGFGRGQNHNVQGFHPYRR                 351 - 407
//

Text Mined References (29)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
24452013 2014 The splicing activator DAZAP1 integrates splicing control into MEK/Erk-regulated cell proliferation and migration.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23738518 2013 A genome-wide association study for reading and language abilities in two population cohorts.
23658607 2013 Differential translation of Dazap1 transcripts during spermatogenesis.
23111326 2012 Transcription-dependent nuclear localization of DAZAP1 requires an N-terminal signal.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22001406 2012 Acetylation of Prrp K150 regulates the subcellular localization.
21858080 2011 Interaction of hnRNPA1/A2 and DAZAP1 with an Alu-derived intronic splicing enhancer regulates ATM aberrant splicing.
21576381 2011 DAZAP1, an RNA-binding protein required for development and spermatogenesis, can regulate mRNA translation.
21269460 2011 Initial characterization of the human central proteome.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19285026 2009 DAZAP1 interacts via its RNA-recognition motifs with the C-termini of other RNA-binding proteins.
18391021 2008 Binding of DAZAP1 and hnRNPA1/A2 to an exonic splicing silencer in a natural BRCA1 exon 18 mutant.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16848763 2006 Phosphorylation of the ARE-binding protein DAZAP1 by ERK2 induces its dissociation from DAZ.
16209998 2005 Expression patterns of the DAZ-associated protein DAZAP1 in rat and human ovaries.
15744350 2005 Cloning and functional characterization of MEF2D/DAZAP1 and DAZAP1/MEF2D fusion proteins created by a variant t(1;19)(q23;p13.3) in acute lymphoblastic leukemia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12185095 Deleted in azoospermia associated protein 1 shuttles between nucleus and cytoplasm during normal germ cell maturation.
11604102 2001 Characterization of the mouse Dazap1 gene encoding an RNA-binding protein that interacts with infertility factors DAZ and DAZL.
10857750 2000 Identification of two novel proteins that interact with germ-cell-specific RNA-binding proteins DAZ and DAZL1.