Property Summary

NCBI Gene PubMed Count 21
PubMed Score 24.09
PubTator Score 13.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -2.554 0.000
acute quadriplegic myopathy 1.054 0.000
breast carcinoma 1.600 0.003
sonic hedgehog group medulloblastoma 1.100 0.000
ovarian cancer 1.600 0.000

Synonym

Accession Q96EP5 Q96MJ3 Q9NRR9
Symbols

Gene

PDB

2DGS   2DH8  

Gene RIF (10)

PMID Text
24452013 The splicing activator DAZAP1 integrates splicing control into MEK/Erk-regulated cell proliferation and migration.
23111326 this study reports the mapping of a 42-amino acid segment (N42) at the N-terminus of DAZAP1 that is both necessary and sufficient for its transcription-dependent nuclear localization.
22174317 HIV-1 Rev interacting protein, DAZ-associated protein 1 (DAZAP1), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa. The interaction of Rev with DAZAP1 is increased by RRE
21858080 Data show that hnRNPA1/A2, HuR and DAZAP1 splicing factors and DHX36 RNA helicase bind to the ISE, with hnRNPA1 acting negatively and DAZAP1 positively on splicing selection
21576381 DAZAP1 can regulate mRNA translation.
19285026 The results suggest that DAZAP1 is a component of complexes that are crucial for the degradation and silencing of mRNA.
18391021 The binding of the splicing factors hnRNPA1/A2 and DAZAP1 is the primary determinant of T6 BRCA1 exon 18 exclusion.
16848763 DAZ cannot bind simultaneously to DAZAP1 and poly(A)-binding protein (PABP), and suggest that the phosphorylation-induced dissociation of DAZ and DAZAP1 may allow the former to stimulate translation by interacting with PABP.
16209998 This study shows expression patterns of DAZAP1 in human corpus luteum cells and demonstrates the in vivo interaction of DAZ-like protein (DAZL) with DAZAP1.
15744350 data suggest that MEF2D/DAZAP1 and/or DAZAP1/MEF2D contribute to leukemogenesis by altering signaling pathways normally regulated by wild-type MEF2D and DAZAP1

AA Sequence

MNNSGADEIGKLFVGGLDWSTTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTVLAS      1 - 70
RPHTLDGRNIDPKPCTPRGMQPERTRPKEGWQKGPRSDNSKSNKIFVGGIPHNCGETELREYFKKFGVVT     71 - 140
EVVMIYDAEKQRPRGFGFITFEDEQSVDQAVNMHFHDIMGKKVEVKRAEPRDSKSQAPGQPGASQWGSRV    141 - 210
VPNAANGWAGQPPPTWQQGYGPQGMWVPAGQAIGGYGPPPAGRGAPPPPPPFTSYIVSTPPGGFPPPQGF    211 - 280
PQGYGAPPQFSFGYGPPPPPPDQFAPPGVPPPPATPGAAPLAFPPPPSQAAPDMSKPPTAQPDFPYGQYA    281 - 350
GYGQDLSGFGQGFSDPSQQPPSYGGPSVPGSGGPPAGGSGFGRGQNHNVQGFHPYRR                 351 - 407
//

Text Mined References (29)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
24452013 2014 The splicing activator DAZAP1 integrates splicing control into MEK/Erk-regulated cell proliferation and migration.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23738518 2013 A genome-wide association study for reading and language abilities in two population cohorts.
23658607 2013 Differential translation of Dazap1 transcripts during spermatogenesis.
23111326 2012 Transcription-dependent nuclear localization of DAZAP1 requires an N-terminal signal.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
More...