Property Summary

NCBI Gene PubMed Count 77
PubMed Score 103.60
PubTator Score 116.65

Knowledge Summary


No data available


  Disease Sources (3)

Disease Target Count P-value
malignant mesothelioma 3163 5.55416114762302E-8
ovarian cancer 8492 1.06781593660782E-6
Pick disease 1893 2.01934853582937E-6
osteosarcoma 7933 9.14211576107316E-4
glioblastoma 5572 0.00332664591064787
progressive supranuclear palsy 674 0.00736339769006714
Disease Target Count Z-score Confidence
Cancer 2346 4.087 2.0


  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma -2.800 0.000
osteosarcoma -1.537 0.001
glioblastoma 1.100 0.003
Pick disease -1.700 0.000
progressive supranuclear palsy -1.400 0.007
ovarian cancer 2.400 0.000


Accession Q96EP1 A6NEN5 B4DZ77 B4E2L6 Q96SL3 Q9NRT4 Q9NT32 Q9NVD5
Symbols RNF116


PANTHER Protein Class (2)


1LGP   1LGQ   2XOC   2XOY   2XOZ   2XP0  

  Ortholog (12)

 GO Component (2)

 GWAS Trait (1)

Gene RIF (68)

26542416 Data show that hypermethylation of the CHFR promoter, frequent in acute myeloid leukemia, is associated with adverse outcome, and can thus be used for risk stratification.
26356822 Small molecule inhibition of CHFR-PARP1 interaction is a novel potential therapeutic approach to increase the efficacy of taxane-based chemotherapy in cancer.
25828518 CHFR methylation has a role in methylation of DNA damage repair and apoptotic pathway genes in non-small cell lung cancer
25798877 Aberrant methylation of CHFR may be associated with the pathogenesis, progression for B-cell non-Hodgkin lymphoma(B-NHL), which might be a novel molecular marker as prognosis and treatment for B-NHL.
25304615 CHFR-PAX5 fusion transcript is associated with B-cell precursor acute lymphoblastic leukemia.
24928946 CHFR promoter methylation is associated with colorectal cancer.
24748501 CHFR unmethylation is associated with oxaliplatin resistance in gastric cancer.
24639283 CHFR methylation may have a role in chemosensitivity of paclitaxel in advanced gastric cancer
24375389 Studies indicate that checkpoint with forkhead and ring finger domains (CHFR) promoter CpG island methylation as prognostic marker.
24012691 CHFR ubiquitinates and regulates TOPK levels, which is essential for its checkpoint function.

AA Sequence

SRPDCYWGRNCRTQVKAHHAMKFNHICEQTRFKN                                        631 - 664

Text Mined References (82)

PMID Year Title
26542416 2016 CHFR hypermethylation, a frequent event in acute myeloid leukemia, is independently associated with an adverse outcome.
26356822 2015 Small molecule inhibition of the CHFR-PARP1 interaction as novel approach to overcome intrinsic taxane resistance in cancer.
25828518 2015 CHFR methylation strongly correlates with methylation of DNA damage repair and apoptotic pathway genes in non-small cell lung cancer.
25798877 2015 Aberrant expression of the CHFR prophase checkpoint gene in human B-cell non-Hodgkin lymphoma.
25304615 2015 Three novel fusion transcripts of the paired box 5 gene in B-cell precursor acute lymphoblastic leukemia.
24928946 2014 CHFR promoter methylation indicates poor prognosis in stage II microsatellite stable colorectal cancer.
24748501 2015 Predictive value of CHFR and MLH1 methylation in human gastric cancer.
24684796 2014 Heritability and genetic association analysis of cognition in the Diabetes Heart Study.
24639283 2014 Association between CHFR methylation and chemosensitivity of paclitaxel in advanced gastric cancer.
24375389 2014 Emerging evidence for CHFR as a cancer biomarker: from tumor biology to precision medicine.