Property Summary

NCBI Gene PubMed Count 78
PubMed Score 107.67
PubTator Score 116.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
non-small cell lung carcinoma 317
Disease Target Count P-value
malignant mesothelioma 3232 5.6e-08
ovarian cancer 8520 1.1e-06
Pick disease 1894 2.0e-06
osteosarcoma 7950 9.1e-04
glioblastoma 5792 3.3e-03
progressive supranuclear palsy 676 7.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Cancer 2499 4.105 2.1

Expression

  Differential Expression (6)

Disease log2 FC p
glioblastoma 1.100 3.3e-03
malignant mesothelioma -2.800 5.6e-08
osteosarcoma -1.537 9.1e-04
ovarian cancer 2.400 1.1e-06
Pick disease -1.700 2.0e-06
progressive supranuclear palsy -1.400 7.4e-03

 GO Component (2)

Gene RIF (69)

AA Sequence

MERPEEGKQSPPPQPWGRLLRLGAEEGEPHVLLRKREWTIGRRRGCDLSFPSNKLVSGDHCRIVVDEKSG      1 - 70
QVTLEDTSTSGTVINKLKVVKKQTCPLQTGDVIYLVYRKNEPEHNVAYLYESLSEKQGMTQESFEANKEN     71 - 140
VFHGTKDTSGAGAGRGADPRVPPSSPATQVCFEEPQPSTSTSDLFPTASASSTEPSPAGRERSSSCGSGG    141 - 210
GGISPKGSGPSVASDEVSSFASALPDRKTASFSSLEPQDQEDLEPVKKKMRGDGDLDLNGQLLVAQPRRN    211 - 280
AQTVHEDVRAAAGKPDKMEETLTCIICQDLLHDCVSLQPCMHTFCAACYSGWMERSSLCPTCRCPVERIC    281 - 350
KNHILNNLVEAYLIQHPDKSRSEEDVQSMDARNKITQDMLQPKVRRSFSDEEGSSEDLLELSDVDSESSD    351 - 420
ISQPYVVCRQCPEYRRQAAQPPHCPAPEGEPGAPQALGDAPSTSVSLTTAVQDYVCPLQGSHALCTCCFQ    421 - 490
PMPDRRAEREQDPRVAPQQCAVCLQPFCHLYWGCTRTGCYGCLAPFCELNLGDKCLDGVLNNNSYESDIL    491 - 560
KNYLATRGLTWKNMLTESLVALQRGVFLLSDYRVTGDTVLCYCCGLRSFRELTYQYRQNIPASELPVAVT    561 - 630
SRPDCYWGRNCRTQVKAHHAMKFNHICEQTRFKN                                        631 - 664
//

Text Mined References (83)

PMID Year Title