Property Summary

NCBI Gene PubMed Count 3
PubMed Score 2.00
PubTator Score 3.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
Astrocytoma, Pilocytic 1.300 5.5e-05
cystic fibrosis -1.083 4.1e-05
invasive ductal carcinoma -1.100 7.8e-03
ovarian cancer 1.200 4.0e-04
pancreatic ductal adenocarcinoma liver m... -1.672 2.4e-03
tuberculosis 1.200 9.3e-05

 GO Process (1)

 Compartment GO Term (0)

Gene RIF (2)

AA Sequence

MESALAVPRLPPHDPGTPVLSVVDMHTGGEPLRIVLAGCPEVSGPTLLAKRRYMRQHLDHVRRRLMFEPR      1 - 70
GHRDMYGAVLVPSELPDAHLGVLFLHNEGYSSMCGHAVLALGRFALDFGLVPAPPAGTREARVNIHCPCG     71 - 140
LVTAFVACEDGRSHGPVRFHSVPAFVLATDLMVDVPGHGKVMVDIAYGGAFYAFVTAEKLGLDICSAKTR    141 - 210
DLVDAASAVTEAVKAQFKINHPDSEDLAFLYGTILTDGKDAYTKEPTTNICVFADEQVDRSPTGSGVTAR    211 - 280
IALQYHKGLLELNQMRAFKSSATGSVFTGKAVREAKCGDFKAVIVEVSGQAHYTGTASFIIEDDDPLRDG    281 - 350
FLLK                                                                      351 - 354
//

Text Mined References (8)

PMID Year Title