Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.00
PubTator Score 3.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
cystic fibrosis -1.083 0.000
pancreatic ductal adenocarcinoma liver m... -1.672 0.002
tuberculosis 1.200 0.000
pilocytic astrocytoma 1.300 0.000
invasive ductal carcinoma -1.100 0.008
ovarian cancer 1.200 0.000

Gene RIF (2)

PMID Text
22528483 human trans-3-hydroxy-L-proline dehydratase is the first characterized member of a novel family of proline racemase-like enzymes
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MESALAVPRLPPHDPGTPVLSVVDMHTGGEPLRIVLAGCPEVSGPTLLAKRRYMRQHLDHVRRRLMFEPR      1 - 70
GHRDMYGAVLVPSELPDAHLGVLFLHNEGYSSMCGHAVLALGRFALDFGLVPAPPAGTREARVNIHCPCG     71 - 140
LVTAFVACEDGRSHGPVRFHSVPAFVLATDLMVDVPGHGKVMVDIAYGGAFYAFVTAEKLGLDICSAKTR    141 - 210
DLVDAASAVTEAVKAQFKINHPDSEDLAFLYGTILTDGKDAYTKEPTTNICVFADEQVDRSPTGSGVTAR    211 - 280
IALQYHKGLLELNQMRAFKSSATGSVFTGKAVREAKCGDFKAVIVEVSGQAHYTGTASFIIEDDDPLRDG    281 - 350
FLLK                                                                      351 - 354
//

Text Mined References (8)

PMID Year Title
24649405 2014 Identification and characterization of trans-3-hydroxy-l-proline dehydratase and ?(1)-pyrroline-2-carboxylate reductase involved in trans-3-hydroxy-l-proline metabolism of bacteria.
22528483 2012 Identification of a human trans-3-hydroxy-L-proline dehydratase, the first characterized member of a novel family of proline racemase-like enzymes.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.