Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.87
PubTator Score 0.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Cleft Lip 141 3.238 1.6
Cleft Palate 271 3.098 1.5

Expression

Gene RIF (1)

AA Sequence

MAAALARLGLRPVKQVRVQFCPFEKNVESTRTFLQTVSSEKVRSTNLNCSVIADVRHDGSEPCVDVLFGD      1 - 70
GHRLIMRGAHLTALEMLTAFASHIRARDAAGSGDKPGADTGR                                 71 - 112
//

Text Mined References (12)

PMID Year Title