Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.37
PubTator Score 0.37

Knowledge Summary

Patent

No data available

Synonym

Accession Q96EL3 L53mt
Symbols L53MT

Gene

PDB

3J9M   3J7Y  

AA Sequence

MAAALARLGLRPVKQVRVQFCPFEKNVESTRTFLQTVSSEKVRSTNLNCSVIADVRHDGSEPCVDVLFGD      1 - 70
GHRLIMRGAHLTALEMLTAFASHIRARDAAGSGDKPGADTGR                                 71 - 112
//

Text Mined References (10)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25278503 2014 Structure of the large ribosomal subunit from human mitochondria.
21269460 2011 Initial characterization of the human central proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12706105 2003 Identification and characterization of over 100 mitochondrial ribosomal protein pseudogenes in the human genome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11551941 2001 The large subunit of the mammalian mitochondrial ribosome. Analysis of the complement of ribosomal proteins present.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.