Property Summary

NCBI Gene PubMed Count 17
PubMed Score 1.00
PubTator Score 0.25

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (10)

Gene RIF (1)

AA Sequence

MAASVCSGLLGPRVLSWSRELPCAWRALHTSPVCAKNRAARVRVSKGDKPVTYEEAHAPHYIAHRKGWLS      1 - 70
LHTGNLDGEDHAAERTVEDVFLRKFMWGTFPGCLADQLVLKRRGNQLEICAVVLRQLSPHKYYFLVGYSE     71 - 140
TLLSYFYKCPVRLHLQTVPSKVVYKYL                                               141 - 167
//

Text Mined References (20)

PMID Year Title