Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.18
PubTator Score 0.67

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

AA Sequence

MHSARLDSFLSQLRWELLCGRDTGSPSMPGPLQPTSQTGPDVQPSHQLRASGALEEDSVCCVEEEEEEEE      1 - 70
EAVVTEDRDAALGGPREHALDWDSGFSEVSGSTWREEELPVSQRPAPSAQPLRRQCLSVSGLPMPSRAPV     71 - 140
ASVPPVHHPRPKSTPDACLEHWQGLEAEDWTAALLNRGRSRQPLVLGDNCFADLVHNWMELPETGSEGGD    141 - 210
GGGHRARARPPQFLLGLSEQLRRRLARARRTAMAGKRLSCPPRPEPELPADVSRFAALMSCRSRQPIICN    211 - 280
DVSYL                                                                     281 - 285
//

Text Mined References (9)

PMID Year Title