Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.18
PubTator Score 0.67

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
26607847 Inka1 is an endogenous inhibitor of PAK4 that binds to the catalytic domain and forms crystals with PAK4 in cells.

AA Sequence

MHSARLDSFLSQLRWELLCGRDTGSPSMPGPLQPTSQTGPDVQPSHQLRASGALEEDSVCCVEEEEEEEE      1 - 70
EAVVTEDRDAALGGPREHALDWDSGFSEVSGSTWREEELPVSQRPAPSAQPLRRQCLSVSGLPMPSRAPV     71 - 140
ASVPPVHHPRPKSTPDACLEHWQGLEAEDWTAALLNRGRSRQPLVLGDNCFADLVHNWMELPETGSEGGD    141 - 210
GGGHRARARPPQFLLGLSEQLRRRLARARRTAMAGKRLSCPPRPEPELPADVSRFAALMSCRSRQPIICN    211 - 280
DVSYL                                                                     281 - 285
//

Text Mined References (8)

PMID Year Title
26607847 2015 An in cellulo-derived structure of PAK4 in complex with its inhibitor Inka1.
25416956 2014 A proteome-scale map of the human interactome network.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
20175189 2010 Generation and characterization of a novel neural crest marker allele, Inka1-LacZ, reveals a role for Inka1 in mouse neural tube closure.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.