Property Summary

NCBI Gene PubMed Count 3
PubMed Score 13.94
PubTator Score 3.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Ostertagiasis 3 5.718 2.9

Expression

  Differential Expression (3)

Disease log2 FC p
astrocytic glioma -1.100 1.9e-02
group 3 medulloblastoma 1.300 1.3e-05
pancreatic ductal adenocarcinoma liver m... -1.261 2.5e-02

Synonym

Accession Q96EK9
Symbols TOT4
SBBI81

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

 GO Function (1)

 Compartment GO Term (0)

AA Sequence

MPLVVFCGLPYSGKSRRAEELRVALAAEGRAVYVVDDAAVLGAEDPAVYGDSAREKALRGALRASVERRL      1 - 70
SRHDVVILDSLNYIKGFRYELYCLARAARTPLCLVYCVRPGGPIAGPQVAGANENPGRNVSVSWRPRAEE     71 - 140
DGRAQAAGSSVLRELHTADSVVNGSAQADVPKELEREESGAAESPALVTPDSEKSAKHGSGAFYSPELLE    141 - 210
ALTLRFEAPDSRNRWDRPLFTLVGLEEPLPLAGIRSALFENRAPPPHQSTQSQPLASGSFLHQLDQVTSQ    211 - 280
VLAGLMEAQKSAVPGDLLTLPGTTEHLRFTRPLTMAELSRLRRQFISYTKMHPNNENLPQLANMFLQYLS    281 - 350
QSLH                                                                      351 - 354
//

Text Mined References (10)

PMID Year Title