Property Summary

NCBI Gene PubMed Count 7
Grant Count 14
R01 Count 14
Funding $754,464.11
PubMed Score 26.90
PubTator Score 0.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
ependymoma -1.200 0.050
osteosarcoma -1.221 0.020
pancreatic ductal adenocarcinoma liver m... -1.914 0.020
active Crohn's disease 1.048 0.011
ovarian cancer 2.100 0.000

Gene RIF (1)

PMID Text
18675810 Crystal structures of human GNA1, including apo GNA1, the GNA1-GlcN6P complex and an E156A mutant were reported.

AA Sequence

MKPDETPMFDPSLLKEVDWSQNTATFSPAISPTHPGEGLVLRPLCTADLNRGFFKVLGQLTETGVVSPEQ      1 - 70
FMKSFEHMKKSGDYYVTVVEDVTLGQIVATATLIIEHKFIHSCAKRGRVEDVVVSDECRGKQLGKLLLST     71 - 140
LTLLSKKLNCYKITLECLPQNVGFYKKFGYTVSEENYMCRRFLK                              141 - 184
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
21269460 2011 Initial characterization of the human central proteome.
18675810 2008 Acceptor substrate binding revealed by crystal structure of human glucosamine-6-phosphate N-acetyltransferase 1.
18601654 2008 Structural and kinetic differences between human and Aspergillus fumigatus D-glucosamine-6-phosphate N-acetyltransferase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9972309 1998 Partial purification and kinetic properties of three different D-glucosamine 6-P:N-acetyltransferase forms from human placenta.