Property Summary

NCBI Gene PubMed Count 8
PubMed Score 29.39
PubTator Score 0.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
active Crohn's disease 1.048 1.1e-02
ependymoma -1.200 5.0e-02
osteosarcoma -1.221 2.0e-02
ovarian cancer 2.100 9.6e-06
pancreatic ductal adenocarcinoma liver m... -1.914 2.0e-02

Synonym

Accession Q96EK6
Symbols GNA1
GNPNAT
Gpnat1

Gene

PDB

2HUZ   2O28   3CXP   3CXQ   3CXS  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MKPDETPMFDPSLLKEVDWSQNTATFSPAISPTHPGEGLVLRPLCTADLNRGFFKVLGQLTETGVVSPEQ      1 - 70
FMKSFEHMKKSGDYYVTVVEDVTLGQIVATATLIIEHKFIHSCAKRGRVEDVVVSDECRGKQLGKLLLST     71 - 140
LTLLSKKLNCYKITLECLPQNVGFYKKFGYTVSEENYMCRRFLK                              141 - 184
//

Text Mined References (11)

PMID Year Title