Property Summary

NCBI Gene PubMed Count 17
PubMed Score 48.30
PubTator Score 121.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count P-value
adult high grade glioma 3801 3.4e-06
ovarian cancer 8520 5.4e-06
medulloblastoma, large-cell 6241 5.0e-05
medulloblastoma 720 8.7e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Hirschsprung's disease 46 3.934 2.0

Expression

  Differential Expression (4)

Disease log2 FC p
adult high grade glioma -1.400 3.4e-06
medulloblastoma -1.100 8.7e-04
medulloblastoma, large-cell -2.000 5.0e-05
ovarian cancer -1.600 5.4e-06

Gene RIF (6)

AA Sequence

MANVPWAEVCEKFQAALALSRVELHKNPEKEPYKSKYSARALLEEVKALLGPAPEDEDERPEAEDGPGAG      1 - 70
DHALGLPAEVVEPEGPVAQRAVRLAVIEFHLGVNHIDTEELSAGEEHLVKCLRLLRRYRLSHDCISLCIQ     71 - 140
AQNNLGILWSEREEIETAQAYLESSEALYNQYMKEVGSPPLDPTERFLPEEEKLTEQERSKRFEKVYTHN    141 - 210
LYYLAQVYQHLEMFEKAAHYCHSTLKRQLEHNAYHPIEWAINAATLSQFYINKLCFMEARHCLSAANVIF    211 - 280
GQTGKISATEDTPEAEGEVPELYHQRKGEIARCWIKYCLTLMQNAQLSMQDNIGELDLDKQSELRALRKK    281 - 350
ELDEEESIRKKAVQFGTGELCDAISAVEEKVSYLRPLDFEEARELFLLGQHYVFEAKEFFQIDGYVTDHI    351 - 420
EVVQDHSALFKVLAFFETDMERRCKMHKRRIAMLEPLTVDLNPQYYLLVNRQIQFEIAHAYYDMMDLKVA    421 - 490
IADRLRDPDSHIVKKINNLNKSALKYYQLFLDSLRDPNKVFPEHIGEDVLRPAMLAKFRVARLYGKIITA    491 - 560
DPKKELENLATSLEHYKFIVDYCEKHPEAAQEIEVELELSKEMVSLLPTKMERFRTKMALT             561 - 621
//

Text Mined References (22)

PMID Year Title