Property Summary

NCBI Gene PubMed Count 21
PubMed Score 15.16
PubTator Score 19.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
malignant mesothelioma 3232 1.6e-06
Breast cancer 3578 3.4e-02
Disease Target Count Z-score Confidence
Glycine encephalopathy 29 3.301 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
Breast cancer 2.400 3.4e-02
malignant mesothelioma 1.100 1.6e-06

Gene RIF (11)

AA Sequence

MPGFTCCVPGCYNNSHRDKALHFYTFPKDAELRRLWLKNVSRAGVSGCFSTFQPTTGHRLCSVHFQGGRK      1 - 70
TYTVRVPTIFPLRGVNERKVARRPAGAAAARRRQQQQQQQQQQQQQQQQQQQQQQQQQQQQQSSPSASTA     71 - 140
QTAQLQPNLVSASAAVLLTLQATVDSSQAPGSVQPAPITPTGEDVKPIDLTVQVEFAAAEGAAAAAAASE    141 - 210
LQAATAGLEAAECPMGPQLVVVGEEGFPDTGSDHSYSLSSGTTEEELLRKLNEQRDILALMEVKMKEMKG    211 - 280
SIRHLRLTEAKLREELREKDRLLAMAVIRKKHGM                                        281 - 314
//

Text Mined References (23)

PMID Year Title