Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.82
PubTator Score 2.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma 1.200 1.0e-02
ependymoma 1.300 3.2e-02
group 3 medulloblastoma 2.700 2.3e-06
medulloblastoma, large-cell 2.100 1.8e-03
oligodendroglioma 1.300 1.4e-02
primitive neuroectodermal tumor 1.300 1.6e-02
psoriasis -1.300 7.2e-06

Gene RIF (3)

AA Sequence

MELQSRPEALAVELARHQNGDLKKQLHERQPRIAALSDKQALGTITAVPVTGPQVSSLQRLAGQGAAVLP      1 - 70
QVRPKTLIPDSLPVAPGRDRPPKQPPTFQKATVVSVKNPSPALPTANNTVSHVPAPGSQPQALAEPAALA     71 - 140
SPLSSAGVAYAIISTSPSNAAAMAPSTAVSVVSDSIKVQPLLISADNKPPPRLLSSPHPATHHCPLHPSS    141 - 210
LPLTPPSPSLSPSPLHGIFQVIIIQPQVQTQPESTAESRPPTEEPSQGAQATKKKKEDRPPTQENPEKIA    211 - 280
FMVALGLVTTEHLEEIQSKRQERKRRSTANPAYSGLLETERKRLASNYLNNPLFLTARANEDPCWKNEIT    281 - 350
HDEHCAACKRGANLQPCGTCPGAYHLSCLEPPLKTAPKGVWVCPRCQQKALKKDEGVPWTGMLAIVHSYV    351 - 420
THKTVKEEEKQKLLQRGSELQNEHQQLEERDRRLASAVQKCLELKTSLLARQRGTQSSLDRLRALLRLIQ    421 - 490
GEQLLQVTMTTTSPAPLLAGPWTKPSVAATHPTVQHPQGHN                                 491 - 531
//

Text Mined References (10)

PMID Year Title