Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.25
PubTator Score 2.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
sonic hedgehog group medulloblastoma 1482 1.65510676242159E-10
psoriasis 6685 7.22939804136909E-6
medulloblastoma, large-cell 6234 3.30474523193591E-5
primitive neuroectodermal tumor 3031 0.00115207815101956
astrocytic glioma 2241 0.0100136335448557
oligodendroglioma 2849 0.0144394799599208
ependymoma 2514 0.0315822395385643

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma 1.200 0.010
ependymoma 1.300 0.032
oligodendroglioma 1.300 0.014
sonic hedgehog group medulloblastoma 3.500 0.000
medulloblastoma, large-cell 3.000 0.000
primitive neuroectodermal tumor 2.000 0.001
psoriasis -1.300 0.000

Synonym

Accession Q96EK2 B0QYW3 B0QYW4 B3KRU4 B7Z4F8 Q5TFL2 Q6ICC0
Symbols PHF4
BHC80L

Gene

  Ortholog (9)

Species Source
Chimp OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Horse OMA Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

Gene RIF (2)

PMID Text
25454821 These data suggest that PHF21B is a novel tumor suppressor gene that can be inactivated by genetic and epigenetic mechanisms in the human cancer.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MELQSRPEALAVELARHQNGDLKKQLHERQPRIAALSDKQALGTITAVPVTGPQVSSLQRLAGQGAAVLP      1 - 70
QVRPKTLIPDSLPVAPGRDRPPKQPPTFQKATVVSVKNPSPALPTANNTVSHVPAPGSQPQALAEPAALA     71 - 140
SPLSSAGVAYAIISTSPSNAAAMAPSTAVSVVSDSIKVQPLLISADNKPPPRLLSSPHPATHHCPLHPSS    141 - 210
LPLTPPSPSLSPSPLHGIFQVIIIQPQVQTQPESTAESRPPTEEPSQGAQATKKKKEDRPPTQENPEKIA    211 - 280
FMVALGLVTTEHLEEIQSKRQERKRRSTANPAYSGLLETERKRLASNYLNNPLFLTARANEDPCWKNEIT    281 - 350
HDEHCAACKRGANLQPCGTCPGAYHLSCLEPPLKTAPKGVWVCPRCQQKALKKDEGVPWTGMLAIVHSYV    351 - 420
THKTVKEEEKQKLLQRGSELQNEHQQLEERDRRLASAVQKCLELKTSLLARQRGTQSSLDRLRALLRLIQ    421 - 490
GEQLLQVTMTTTSPAPLLAGPWTKPSVAATHPTVQHPQGHN                                 491 - 531
//

Text Mined References (9)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25454821 2015 PHF21B as a candidate tumor suppressor gene in head and neck squamous cell carcinomas.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.