Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.08
PubTator Score 2.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
intraductal papillary-mucinous carcinoma... -1.300 1.7e-02
malignant mesothelioma -1.300 1.1e-06
Multiple myeloma 1.779 9.5e-04
ovarian cancer -2.100 1.6e-06
Pneumonia -1.100 9.8e-03

Gene RIF (1)

AA Sequence

MEKLYSENEGMASNQGKMENEEQPQDERKPEVTCTLEDKKLENEGKTENKGKTGDEEMLKDKGKPESEGE      1 - 70
AKEGKSEREGESEMEGGSEREGKPEIEGKPESEGEPGSETRAAGKRPAEDDVPRKAKRKTNKGLAHYLKE     71 - 140
YKEAIHDMNFSNEDMIREFDNMAKVQDEKRKSKQKLGAFLWMQRNLQDPFYPRGPREFRGGCRAPRRDIE    141 - 210
DIPYV                                                                     211 - 215
//

Text Mined References (18)

PMID Year Title