Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.13
PubTator Score 3.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Synonym

Accession Q96EH5 Q8IUD0
Symbols RPL39L1

Gene

Gene RIF (4)

PMID Text
24998577 High RPL39L expression is associated with drug-resistant lacrimal gland adenoid cystic carcinoma.
24815453 The ribosomal protein L39-L gene may have effects on the drug resistance mechanism of lung cancer A549 cells.
24452241 Results show the RP paralog Rpl39l is highly expressed in Embryonic Stem Cells and its expression strongly correlates with hepatocellular carcinoma tumor (HCC) samples with high tumor grading and alpha-fetoprotein level giving it diagnostic potential.
12359333 locus, structure and expression of the gene and its relevance to the biological activities of the ribosome

AA Sequence

MSSHKTFTIKRFLAKKQKQNRPIPQWIQMKPGSKIRYNSKRRHWRRTKLGL                         1 - 51
//

Text Mined References (9)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24998577 2014 Influence of ribosomal protein L39-L in the drug resistance mechanisms of lacrimal gland adenoid cystic carcinoma cells.
24815453 2014 Effects of ribosomal protein l39-L on the drug resistance mechanisms of lung cancer A549 cells.
24452241 2014 RPL39L is an example of a recently evolved ribosomal protein paralog that shows highly specific tissue expression patterns and is upregulated in ESCs and HCC tumors.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12490704 2002 Functional second genes generated by retrotransposition of the X-linked ribosomal protein genes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12359333 2002 A human gene encoding a protein homologous to ribosomal protein L39 is normally expressed in the testis and derepressed in multiple cancer cells.