Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.13
PubTator Score 3.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
active Crohn's disease 1.701 9.5e-03
acute myeloid leukemia -2.400 3.4e-03
adrenocortical carcinoma 1.274 7.1e-03
astrocytic glioma -1.900 1.1e-02
intraductal papillary-mucinous neoplasm ... 1.300 8.2e-04
lung adenocarcinoma 1.200 2.1e-10
lung cancer 2.600 6.4e-05
malignant mesothelioma 2.700 1.8e-08
medulloblastoma, large-cell -1.500 9.0e-03
non-small cell lung cancer 2.508 1.7e-25
oligodendroglioma -1.600 3.0e-02

Gene RIF (4)

AA Sequence

MSSHKTFTIKRFLAKKQKQNRPIPQWIQMKPGSKIRYNSKRRHWRRTKLGL                         1 - 51
//

Text Mined References (11)

PMID Year Title