Property Summary

NCBI Gene PubMed Count 12
PubMed Score 10.19
PubTator Score 11.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
lung carcinoma 1.100 0.000

Synonym

Accession Q96EG1 Q6UXF2 Q9Y2K4 ASG
Symbols

Gene

PANTHER Protein Class (1)

Gene RIF (8)

PMID Text
25825126 This study provide further support for a role of ARSG variants in task-specific dystonia, especially writer's cramp.
25135642 ARSG is differentially expressed, processed, and transported in tissues involving a membrane-associated pre-lysosomal precursor.
24375517 Genome-wide significance with musician's dystonia was observed for an intronic variant in the arylsulfatase G (ARSG) gene (rs11655081; P = 3.95 x 10(-9) ; odds ratio [OR], 4.33; 95% confidence interval [CI], 2.66-7.05).
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19960030 Consistent genetic factors for ATP2B1, CSK, ARSG and CSMD1 were present, which have been shown to be associated with high blood pressure and hypertension in two Korean cohorts.
19960030 Observational study of gene-disease association. (HuGE Navigator)
18283100 Arylsulfatase G is a novel lysosomal sulfatase and its expression is tissue-specific with highest expression in liver, kidney, and pancreas
12461688 molecular cloning and biochemical characterization of Arylsulfatase G [ARSG]

AA Sequence

MGWLFLKVLLAGVSFSGFLYPLVDFCISGKTRGQKPNFVIILADDMGWGDLGANWAETKDTANLDKMASE      1 - 70
GMRFVDFHAAASTCSPSRASLLTGRLGLRNGVTRNFAVTSVGGLPLNETTLAEVLQQAGYVTGIIGKWHL     71 - 140
GHHGSYHPNFRGFDYYFGIPYSHDMGCTDTPGYNHPPCPACPQGDGPSRNLQRDCYTDVALPLYENLNIV    141 - 210
EQPVNLSSLAQKYAEKATQFIQRASTSGRPFLLYVALAHMHVPLPVTQLPAAPRGRSLYGAGLWEMDSLV    211 - 280
GQIKDKVDHTVKENTFLWFTGDNGPWAQKCELAGSVGPFTGFWQTRQGGSPAKQTTWEGGHRVPALAYWP    281 - 350
GRVPVNVTSTALLSVLDIFPTVVALAQASLPQGRRFDGVDVSEVLFGRSQPGHRVLFHPNSGAAGEFGAL    351 - 420
QTVRLERYKAFYITGGARACDGSTGPELQHKFPLIFNLEDDTAEAVPLERGGAEYQAVLPEVRKVLADVL    421 - 490
QDIANDNISSADYTQDPSVTPCCNPYQIACRCQAA                                       491 - 525
//

Text Mined References (12)

PMID Year Title
25825126 2015 Accumulation of rare variants in the arylsulfatase G (ARSG) gene in task-specific dystonia.
25135642 2014 Molecular characterization of arylsulfatase G: expression, processing, glycosylation, transport, and activity.
24375517 2014 Genome-wide association study in musician's dystonia: a risk variant at the arylsulfatase G locus?
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19960030 2010 Genetic variations in ATP2B1, CSK, ARSG and CSMD1 loci are related to blood pressure and/or hypertension in two Korean cohorts.
18283100 2008 Arylsulfatase G, a novel lysosomal sulfatase.
16174644 2005 Sulfatases and sulfatase modifying factors: an exclusive and promiscuous relationship.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...