Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.31
PubTator Score 2.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
malignant mesothelioma 3163 1.16355175387179E-7
breast carcinoma 1614 3.51318081749309E-5
osteosarcoma 7933 4.51389569620098E-5
group 4 medulloblastoma 1875 8.45948035086251E-5
cutaneous lupus erythematosus 1056 9.51007401607976E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00136049714455895
psoriasis 6685 0.00183705705239422
invasive ductal carcinoma 2950 0.00284405195889565
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00325198196809278
oligodendroglioma 2849 0.00488612944395176
ependymoma 2514 0.00718424159772802
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00967740118943809
fibroadenoma 557 0.0345706790584375

Expression

  Differential Expression (13)

Synonym

Accession Q96EF6 Q96LQ4
Symbols FBG4
FBX26
Fbx17
FBXO26

Gene

  Ortholog (5)

Species Source
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Anole lizard OMA EggNOG

Gene RIF (1)

PMID Text
17672918 the apparent occurrence of an unusual TG 3' splice site in intron 3 is discussed

AA Sequence

MGARLSRRRLPADPSLALDALPPELLVQVLSHVPPRSLVTRCRPVCRAWRDIVDGPTVWLLQLARDRSAE      1 - 70
GRALYAVAQRCLPSNEDKEEFPLCALARYCLRAPFGRNLIFNSCGEQGFRGWEVEHGGNGWAIEKNLTPV     71 - 140
PGAPSQTCFVTSFEWCSKRQLVDLVMEGVWQELLDSAQIEICVADWWGARENCGCVYQLRVRLLDVYEKE    141 - 210
VVKFSASPDPVLQWTERGCRQVSHVFTNFGKGIRYVSFEQYGRDVSSWVGHYGALVTHSSVRVRIRLS      211 - 278
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
18203720 2008 Diversity in tissue expression, substrate binding, and SCF complex formation for a lectin family of ubiquitin ligases.
17672918 2007 Violating the splicing rules: TG dinucleotides function as alternative 3' splice sites in U2-dependent introns.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12383498 2002 A new subfamily of structurally related human F-box proteins.
11178263 2000 The F-box protein family.
10531037 1999 A family of mammalian F-box proteins.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.