Property Summary

NCBI Gene PubMed Count 14
PubMed Score 3.51
PubTator Score 2.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
breast carcinoma -1.100 3.5e-05
cutaneous lupus erythematosus -1.300 9.5e-05
ependymoma -1.100 7.2e-03
fibroadenoma -1.100 3.5e-02
group 4 medulloblastoma -1.400 8.5e-05
intraductal papillary-mucinous adenoma (... -1.200 1.4e-03
intraductal papillary-mucinous carcinoma... -1.400 3.3e-03
intraductal papillary-mucinous neoplasm ... -1.200 9.7e-03
invasive ductal carcinoma -1.100 2.8e-03
malignant mesothelioma -3.100 1.2e-07
oligodendroglioma -1.100 4.9e-03
osteosarcoma 2.661 4.5e-05
psoriasis 1.500 1.8e-03

Synonym

Accession Q96EF6 Q96LQ4
Symbols FBG4
FBX26
Fbx17
FBXO26

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

Gene RIF (3)

AA Sequence

MGARLSRRRLPADPSLALDALPPELLVQVLSHVPPRSLVTRCRPVCRAWRDIVDGPTVWLLQLARDRSAE      1 - 70
GRALYAVAQRCLPSNEDKEEFPLCALARYCLRAPFGRNLIFNSCGEQGFRGWEVEHGGNGWAIEKNLTPV     71 - 140
PGAPSQTCFVTSFEWCSKRQLVDLVMEGVWQELLDSAQIEICVADWWGARENCGCVYQLRVRLLDVYEKE    141 - 210
VVKFSASPDPVLQWTERGCRQVSHVFTNFGKGIRYVSFEQYGRDVSSWVGHYGALVTHSSVRVRIRLS      211 - 278
//

Text Mined References (14)

PMID Year Title