Property Summary

NCBI Gene PubMed Count 7
Grant Count 2
R01 Count 2
Funding $453,400
PubMed Score 2.41
PubTator Score 4.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell 1.200 0.000
non primary Sjogren syndrome sicca -1.100 0.026

Synonym

Accession Q96EF0 Q5JT99 Q9NXP6
Symbols

Gene

PANTHER Protein Class (2)

 Grant Application (2)

PDB

4Y7I  

Gene RIF (2)

PMID Text
26143924 Here, the crystal structure of the phosphatase domain of MTMR8 is reported.
24282552 East African population that gave rise to non-Africans underwent a selective sweep affecting the subcentromeric region where MTMR8 is located

AA Sequence

MDHITVPKVENVKLVDRYVSKKPANGILYLTATHLIYVEASGAARKETWIALHHIATVEKLPITSLGCPL      1 - 70
TLRCKNFRVAHFVLDSDLVCHEVYISLLKLSQPALPEDLYAFSYNPKSSKEMRESGWKLIDPISDFGRMG     71 - 140
IPNRNWTITDANRNYEICSTYPPEIVVPKSVTLGTVVGSSKFRSKERVPVLSYLYKENNAAICRCSQPLS    141 - 210
GFYTRCVDDELLLEAISQTNPGSQFMYVVDTRPKLNAMANRAAGKGYENEDNYANIRFRFMGIENIHVMR    211 - 280
SSLQKLLEVCELKTPTMSEFLSGLESSGWLRHIKAIMDAGIFITKAVKVEKASVLVHCSDGWDRTAQVCS    281 - 350
VASILLDPFYRTFKGLMILIEKEWISMGHKFSQRCGHLDGDSKEVSPIFTQFLDCIWQLMEQFPCAFEFN    351 - 420
ENFLLEIHDHVFSCQFGNFLGNCQKDREDLRVYEKTHSVWPFLVQRKPDFRNPLYKGFTMYGVLNPSTVP    421 - 490
YNIQFWCGMYNRFDKGLQPKQSMLESLLEIKKQRAMLETDVHELEKKLKVRDEPPEEICTCSQLGNILSQ    491 - 560
HLGSPLTNPLGFMGINGDLNTLMENGTLSREGGLRAQMDQVKSQGADLHHNCCEIVGSLRAINISGDVGI    561 - 630
SEAMGISGDMCTFEATGFSKDLGICGAMDISEATGISGNLGISEARGFSGDMGILGDTGISKASTKEADY    631 - 700
SKHQ                                                                      701 - 704
//

Text Mined References (12)

PMID Year Title
26143924 2015 Structure of the catalytic phosphatase domain of MTMR8: implications for dimerization, membrane association and reversible oxidation.
24282552 2013 X-linked MTMR8 diversity and evolutionary history of sub-Saharan populations.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16787938 2006 Systematic analysis of myotubularins: heteromeric interactions, subcellular localisation and endosome related functions.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...