Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.50
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 4.0e-07
Breast cancer 3578 7.8e-05
medulloblastoma, large-cell 6241 2.3e-04
group 3 medulloblastoma 4104 2.1e-02
astrocytic glioma 2597 4.0e-02

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma -1.300 4.0e-02
Breast cancer -1.200 7.8e-05
group 3 medulloblastoma 1.100 2.1e-02
medulloblastoma, large-cell -1.700 2.3e-04
ovarian cancer -1.500 4.0e-07

Synonym

Accession Q96EE4 A8K1J6 Q6UWP1 Q75MQ6
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MFFTISRKNMSQKLSLLLLVFGLIWGLMLLHYTFQQPRHQSSVKLREQILDLSKRYVKALAEENKNTVDV      1 - 70
ENGASMAGYADLKRTIAVLLDDILQRLVKLENKVDYIVVNGSAANTTNGTSGNLVPVTTNKRTNVSGSIR     71 - 140
//

Text Mined References (8)

PMID Year Title