Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.50
PubTator Score 0.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma -1.300 0.040
medulloblastoma, large-cell -1.700 0.000
group 3 medulloblastoma 1.100 0.021
Breast cancer -1.200 0.000
ovarian cancer -1.500 0.000

AA Sequence

MFFTISRKNMSQKLSLLLLVFGLIWGLMLLHYTFQQPRHQSSVKLREQILDLSKRYVKALAEENKNTVDV      1 - 70
ENGASMAGYADLKRTIAVLLDDILQRLVKLENKVDYIVVNGSAANTTNGTSGNLVPVTTNKRTNVSGSIR     71 - 140
//

Text Mined References (8)

PMID Year Title
19946888 2010 Defining the membrane proteome of NK cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9847074 1998 Toward a complete human genome sequence.