Property Summary

NCBI Gene PubMed Count 20
PubMed Score 6.52
PubTator Score 3.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
acute quadriplegic myopathy 1.655 3.4e-06
Amyotrophic lateral sclerosis 1.120 8.1e-06
astrocytic glioma -1.700 1.6e-02
atypical teratoid / rhabdoid tumor -1.300 2.5e-04
Breast cancer 1.300 5.2e-04
dermatomyositis 2.000 1.5e-04
ependymoma -1.800 3.2e-02
lung cancer 1.600 1.2e-03
medulloblastoma, large-cell 1.800 1.8e-06
ovarian cancer -1.600 1.0e-04
subependymal giant cell astrocytoma -1.073 1.7e-02
Waldenstrons macroglobulinemia 1.269 1.3e-02

 MGI Phenotype (1)

Gene RIF (3)

AA Sequence

MFVARSIAADHKDLIHDVSFDFHGRRMATCSSDQSVKVWDKSESGDWHCTASWKTHSGSVWRVTWAHPEF      1 - 70
GQVLASCSFDRTAAVWEEIVGESNDKLRGQSHWVKRTTLVDSRTSVTDVKFAPKHMGLMLATCSADGIVR     71 - 140
IYEAPDVMNLSQWSLQHEISCKLSCSCISWNPSSSRAHSPMIAVGSDDSSPNAMAKVQIFEYNENTRKYA    141 - 210
KAETLMTVTDPVHDIAFAPNLGRSFHILAIATKDVRIFTLKPVRKELTSSGGPTKFEIHIVAQFDNHNSQ    211 - 280
VWRVSWNITGTVLASSGDDGCVRLWKANYMDNWKCTGILKGNGSPVNGSSQQGTSNPSLGSTIPSLQNSL    281 - 350
NGSSAGRKHS                                                                351 - 360
//

Text Mined References (25)

PMID Year Title