Property Summary

NCBI Gene PubMed Count 19
Grant Count 9
R01 Count 6
Funding $832,190.97
PubMed Score 7.32
PubTator Score 3.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.269 0.013
astrocytic glioma -1.700 0.016
ependymoma -1.800 0.032
atypical teratoid / rhabdoid tumor -1.300 0.000
medulloblastoma, large-cell 1.800 0.000
Amyotrophic Lateral Sclerosis 1.120 0.000
acute quadriplegic myopathy 1.655 0.000
lung cancer 1.600 0.001
subependymal giant cell astrocytoma -1.073 0.017
ovarian cancer -1.600 0.000
Breast cancer 1.300 0.001
dermatomyositis 2.000 0.000

 MGI Term (1)

Gene RIF (4)

PMID Text
22190034 HIV-1 gp120 is identified to have a physical interaction with SEH1-like (SEH1L) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22190034 HIV-1 gp120 is identified to have a physical interaction with SEH1-like (SEH1L) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21825076 The assembly of soluble Nup107-160 complexes into higher order structures occurs only at sites on the chromatin surface that are already covered with the nuclear envelope.
14517296 Sec13 stably interacts with Nup96 at the NPC during interphase and the shuttling of Sec13 between the nucleus and the cytoplasm may couple and regulate functions between these two compartments

AA Sequence

MFVARSIAADHKDLIHDVSFDFHGRRMATCSSDQSVKVWDKSESGDWHCTASWKTHSGSVWRVTWAHPEF      1 - 70
GQVLASCSFDRTAAVWEEIVGESNDKLRGQSHWVKRTTLVDSRTSVTDVKFAPKHMGLMLATCSADGIVR     71 - 140
IYEAPDVMNLSQWSLQHEISCKLSCSCISWNPSSSRAHSPMIAVGSDDSSPNAMAKVQIFEYNENTRKYA    141 - 210
KAETLMTVTDPVHDIAFAPNLGRSFHILAIATKDVRIFTLKPVRKELTSSGGPTKFEIHIVAQFDNHNSQ    211 - 280
VWRVSWNITGTVLASSGDDGCVRLWKANYMDNWKCTGILKGNGSPVNGSSQQGTSNPSLGSTIPSLQNSL    281 - 350
NGSSAGRKHS                                                                351 - 360
//

Text Mined References (23)

PMID Year Title
27487210 2016 Mechanism of arginine sensing by CASTOR1 upstream of mTORC1.
27194810 2016 Systematic Protein-Protein Interaction Analysis Reveals Intersubcomplex Contacts in the Nuclear Pore Complex.
26972053 2016 The CASTOR Proteins Are Arginine Sensors for the mTORC1 Pathway.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26391640 2015 Crystal structure of human nuclear pore complex component NUP43.
25457612 2014 Sestrins inhibit mTORC1 kinase activation through the GATOR complex.
25263562 2014 The Sestrins interact with GATOR2 to negatively regulate the amino-acid-sensing pathway upstream of mTORC1.
24315095 2013 Integrated structural analysis of the human nuclear pore complex scaffold.
23723238 2013 A Tumor suppressor complex with GAP activity for the Rag GTPases that signal amino acid sufficiency to mTORC1.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...