Property Summary

NCBI Gene PubMed Count 759
PubMed Score 2958.59
PubTator Score 1855.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
adrenocortical carcinoma -1.894 8.4e-10
ovarian cancer -1.200 1.8e-03

Gene RIF (739)

PMID Text
27333745 It is a protein deacetylase that has been reported to suppress cardiovascular pathologies such as myocardial infarction, and neurodegenerative diseases. (review)
27089876 several common single nucleotide polymorphisms(rs12778366, rs3758391, rs3740051, rs33957861, rs7896005, rs12413112, rs11599176 and rs4746720) in the SIRT1 gene are not associated with human longevity
26999517 rs3758391 and rs12778366 polymorphisms of SIRT1 gene are associated with breast cancer risk and prognosis in the Egyptian population.
26987484 myeloid cell-specific deletion of SIRT1 appeared to suppress CIA by modulating DC maturation.
26975631 SIRT1 expression correlated positively with Fra-1 expression, metastasis and overall survival in patients with colorectal cancer
26896648 Studies indicate that when NAD+ levels drop, SIRT1 protein activity is reduced, leading to mitochondrial dysfunction.
26890260 SIRT1 is an important regulator of lipid and carbohydrate metabolisms within human fetal hepatocytes, acting as an adaptive transcriptional response to environmental changes.
26831453 Although primarily a nuclear protein, Sirt1 deacetylation of PGC-1a has been extensively implicated in metabolic control and mitochondrial biogenesis, which was proposed to partially underlie Sirt1 role in caloric restriction and impacts on longevity. (Review)
26768367 Therefore, our results support a link between PD and SIRT1/HIF-1alpha signaling, which may serve as a clue for understanding PD.
26752489 SIRT1 exerted anti-inflammatory effects in degenerative nucleus pulposus cells through TLR2/SIRT1/NF-kappaB pathway.
26722524 In Hodgkin lymphoma infiltrating lymphocytes, there was a difference of Sirt1 to FoxP3 ratios between remission and recurrence groups, being significantly higher in the recurrence group
26667041 Studies indicate that Many of the metabolic disorders have been associated with a reduction of sirtuins SIRT1 and SIRT3 at critical developmental windows throughout development.
26656366 Genetic variations of SIRT1 could be implicated in the pathophysiology of AGE-RELATED MACULAR DEGENERATION in the Chinese Han population.
26648302 Hyperoxia induces reactive oxygen species production in premature infants, promotes SIRT1 to cross from nucleus to cytoplasm, inhibits the resistant ability of SIRT1 to oxidative stress.
26637398 risk allele A at SIRT1 rs10509291 was closely associated with T2DM, and subjects who were homozygous of the A allele were more likely to develop T2DM
26626483 Data show that Sirt1 interacts with phosphorylated GAPDH mediating its rapid activation and autophagy initiation under glucose deprivation.
26619800 Over-expression of HDAC4 suppressed the transcription of genes involved in energy expenditure in a SIRT1-dependent manner. In contrast, HDAC4 knockdown/inhibition neutralized the effect of IFN-gamma on cellular metabolism by normalizing SIRT1 expression
26612257 Our results identify a new regulatory mechanism of miR-543 on SIRT1 expression in gastric cancer, and raise the possibility that the miR-543/SIRT1 pathway may serve as a potential target for the treatment of gastric cancer.
26601824 Occludin biochemically as a novel NADH oxidase that controls the expression and activation of SIRT-1.
26585892 This study reveals the role of SIRT1 on tumor invasiveness and unfavorable clinical outcomes
26562529 In summary, our study suggested that the downregulation of the miR-543 could alleviate the insulin resistance via the modulation of the SIRT1 expression.
26523671 anti-tumor effect of miR-34a was primarily dependent on the regulation of SIRT1 and p53/p21 protein, not apoptosis-associated proteins
26520405 Benzyl butyl phthalate selectively disrupts sirtuins 1/3 in HepG2 cells to alter epigenetic processes and mitochondrial biogenesis.
26520143 Studied the connection between Sirt1 expression and chemoresistance in serous epithelial ovarian cancer (EOC) and prognosis significance of Sirt1 in serous EOC patients.
26509718 study gave further support for the association of SIRT1 gene with depressive disorders (rs3758391) and diastolic blood pressure (rs2273773).
26499802 PI3K-Akt-GSK3beta signaling pathway is required for SIRT1 induction by ER stress.
26499759 Findings showed that miR-22 functioned as tumor suppressor in renal cell carcinoma (RCC) and blocked RCC growth and metastasis by directly targeting SIRT1.
26460121 TGFbeta interferes with SIRT1 expression and lncRNA HIF1alphaAS1 was significantly downregulated following overexpression of SIRT1.
26443578 A change in the heterodimeric partner of Peroxisome Proliferator Activated Receptor-alpha from retinoid X receptor to Silent information regulator 1 is responsible for the impaired fatty acid metabolism and cardiac dysfunction in the failing heart.
26439987 miR-212 negatively modulates starvation induced autophagy in PCa cells by targeting sirtuin 1
26435214 SIRT1 contributed to apoptosis and reversion of activated LX-2 cells and SIRT1 might be regulated by MALAT1 in liver fibrosis.
26427145 AGE-BSA promoted HMGB1 but down regulated Sirt 1 in human retinal cells, regulating the release of proinflammatory cytokines.
26422395 Data suggest that activation of SIRT1 may improve insulin sensitivity of liver, skeletal muscle, and adipose tissues and protect function and cell mass of pancreatic beta-cells. [REVIEW]
26414199 HDAC4 increases endogenous SIRT1 expression by enhancing its sumoylation modification levels
26413932 SIRT1 overexpression in iPSC-endothelial cells maintains EC phenotype, improves EC function, and extends cell lifespan.
26405826 These observations demonstrate that SIRT1 is a critical regulator of multiple aspects of the high-risk human papillomavirus life cycle.
26398583 The results suggest that SIRT1 is a potential target for the development of combinatorial treatment for adult T-cell leukemia-lymphoma
26367491 involved in the acquisition of the aggressive behavior associated with endometrial carcinoma
26363315 SIRT1 is an attractive therapeutic target for colorectal cancer (CRC); chlorpromazine is a potential repositioned drug for treating CRC
26354378 It regulates insulin secretion and protect cells against oxidative stress.
26352206 Activation of the cAMP/PKA/CREB pathway plays a key role in NAM-induced Sirt1 upregulation.
26345416 SIRT1-mediated mitochondrial and Akt pathways have roles in glioblastoma cell death induced by Cotinus coggygria flavonoid nanoliposomes
26342525 Sirtuin 1 attenuates nasal polypogenesis by suppressing epithelial-to-mesenchymal transition
26318035 SIRT1 is involved in B[a]P-induced transformation associated with activation of the TNF-alpha/beta-catenin axis and is as a potential therapeutic target for lung cancer
26307266 Resveratrol via SIRT1/c-Jun downregulates REST mRNA and protein in SH-SY5Y cells.
26284905 To investigate the effect of silent information regulator 1 (SIRT1) gene polymorphisms on ambulatory blood pressure in hypertensive patients
26284543 NOS stimulation via PI3K, calpain proteases, and SIRT1-dependent deacetylation downstream from VEGFR2 activation contributes to these vasodilator responses.
26280894 support a role of SIRT1 protein as tumor suppressor in luminal A breast cancer
26238659 Fenofibrate upregulates SIRT1 expression through PPARalpha activation in human retinal endothelial cells.
26236947 Data suggest that activation of AMPK (AMP-activated protein kinase) in triple negative breast cancer cells down-regulates expression of MTDH (metadherin) via up-regulation of GSK3B (glycogen synthase kinase 3 beta) and SIRT1 (sirtuin 1) activities.
26233702 Reduced SIRT1 expression correlates with enhanced oxidative stress in compensated and decompensated heart failure.
26225773 SIRT1 may be included in the transduction network activated by estrogens through GPER toward the breast cancer progression.
26181207 Shear stress regulates endothelial cell autophagy via redox regulation and Sirt1 expression.
26174951 inhibitory effect of RSV on the HIF-1alpha/VEGF/VEGFR2 signaling axis is mediated, at least in part, through SIRT1
26168293 increasing Nnmt expression or MNAM levels stabilizes sirtuin 1 protein, an effect that is required for their metabolic benefits
26134520 data establish a specific sirtuin-activating compound-binding site and identify key intermolecular interactions with hSIRT1.
26130063 This study identified that benign paroxysmal positional vertigo patients exhibited relatively higher oxidative stress, and SIRT1 axis genes were downregulated under oxidative stress in benign paroxysmal positional vertigo patients
26113041 Our findings indicate that phosphorylation-dependent restriction of SIRT1 activity by HIPK2 shapes the p53 response
26109180 SIRT1 activation by resveratrol plays a role in cell survival under oxidative stress. [Review]
26104761 EZH2, a component of PRC2 that can affect DNA methylation through association with DNA methyltransferases (DNMTs), did not co-immunoprecipitate with SIRT1, and SIRT1 knockdown did not affect the expression of EZH2 protein.
26063426 SIRT1 Suppresses Human T-Cell Leukemia Virus Type 1 Transcription.
26059423 Carnosic acid can alleviate H2O2-induced hepatocyte damage through the SIRT1 pathway.
26049753 SIRT1 is significantly overexpressed in leukemia stem cells populations from acute myeloid leukemia patients with the FLT3-ITD mutation, and maintains their survival, growth and drug resistance. (Review)
26049033 Data suggest SIRT1 is involved in tumorigenesis through role in autophagy; in gastric cancer, SIRT1 is prognostic marker and is involved in cell proliferation, epithelial-mesenchymal transition, neoplastic invasiveness, and drug resistance. [REVIEW]
26036258 The miR-132/SIRT1/TP53 axis was identified as a novel pathway triggered by BCR engagement that further increases the complexity of the interactions between tumor microenvironments and CLL cells.
26023773 hCdc14B promotes reactivation of rDNA transcription by dephosphorylating TAFI110. SIRT1 becomes transiently enriched in nucleoli at the onset of mitosis. SIRT1 deacetylates TAFI68 destabilizing SL1 binding to the rDNA promoter
26004371 Report different associations between SIRT1 expression and prognosis by molecular subtype breast cancer.
25998694 Findings show the expression of miR-204 frequently downregulated in osteosarcoma cell lines and its overexpression inhibits the proliferation, migration, invasion and epithelial-mesenchymal transition of osteosarcoma cells by directly targeting Sirt1.
25982963 These results show that insulin attenuates arsenic-induced neurite outgrowth impairment possibly via activation of PI3K/Akt/SIRT1 signaling, and arsenic may exert neurite outgrowth inhibition through a mechanism involving reduction of the same molecules.
25982096 Our data indicate a new direction for LOX-1 regulation by the modulation of the PKCbeta/NAPDH oxidase/SIRT1/HSF1 mechanism
25975679 Inhibition of SIRT1 by sirtinol counteracted the protective effects of melatonin, suggesting that melatonin reversed the senescence in cells through the SIRT1-dependent pathway.
25972997 miR-320 may mediate the acute lung injury after cardiopulmonary bypass in which alveolar epithelial cells are injured via down-regulating SIRT1.
25955819 This review focuses on biochemical mechanisms involving enzymes--specifically, mTOR, AMPK, and Sirt1--that are currently considered important for these adaptive responses, providing an overview of the interactions of the main players in this process.
25950477 Increase of HDAC1 acetylation and reduced level of SIRT1 protein during cellular stress directly link to the induction of p53 acetylation. Results unveil the mechanism underlying the dynamic regulation of p53 acetylation during cell stress.
25948680 Maternal overnutrition induces LPL expression in trophoblasts by reducing the inhibitory effect of SIRT1 on PPARgamma.
25946975 Loss of SIRT1 expression is associated with head and neck squamous cell carcinoma.
25926383 The focus of this review was to delineate the carcinogenesis effects of SIRT1 on HCC and present an overview of SIRT1 functions Hepatocellular carcinoma
25924011 In conclusion our data reveal that resveratrol induced premature senescence is associated with SIRT1 and SIRT2 down regulation in human dermal fibroblasts
25922201 Data suggest that exercise intervention (stretching and resistance training) improves low back pain symptoms, up-regulates sirtuin 1 (SIRT1) expression, down-regulates Toll-like receptor 4 (TLR4) expression, and reduces oxidative stress.
25915617 Expression of sirtuin 1 and 2 is associated with poor prognosis in non-small cell lung cancer patients
25905708 study suggests a SIRT1-KAP1 regulatory mechanism for HR-NHEJ repair pathway choice
25905433 Disruption of the molecular clock due to SIRT1 reduction contributes to abnormal inflammatory response in smokers and patients with COPD.
25896587 MiR-34a may be a tiemolecule between the p53 and SIRT1.
25894374 Deacetylation of K-Ras by Sirt1 increased the transformation of Ras-GTP to Ras-GDP, promoting the activation of downstream of ERK1/2. In reverse, Ras/ERK pathway could also regulate Sirt1 transcription.
25890999 the regulatory role of Sirt1 in immune responses
25870236 findings demonstrate MPP8 and SIRT1 reciprocally regulate each other's function at multiple molecular layers through physical interaction; disruption of MPP8-SIRT1 interaction de-represses E cadherin expression and reduces cell motility and invasiveness suggesting this interplay plays critical role in MPP8- and SIRT1-mediated epithelial-mesenchymal transition
25847123 SIRT1 and STAT3 expression protects retinal pigmented epithelium cells against oxidative stress.
25829495 Sirt1, Sirt2, and Sirt3 are expressed in enucleate platelets. Sirt1 inhibition leads to a reduction in reticulated platelets and platelet count. Sirtuins act as a central player in the determination of platelet aging.
25824609 Caloric restriction, resveratrol and melatonin: Role of SIRT1 and implications for aging and related-diseases.
25801465 Data indicate that Werner syndrome helicase (WRN)-mediated DNA repair is regulated by SIRT1 deacetylase.
25799392 Low serum SIRT1 levels are associated with rheumatoid arthritis.
25798752 a severe deregulation of expression of SIRT1 and circadian genes was evidenced in the cancer specimens of Pancreatic cancer patients
25794641 SIRT1 inhibition caused cell death, while SIRT2 inhibition resulted in cell cycle arrest. In conclusion, we report the overexpression of SIRT2 and SIRT7 proteins in cervical cancer
25789761 Bile acids decrease SIRT1 protein expression and activity, thus promoting the deacetylation of peroxisome proliferator-activated receptor gamma, coactivator 1 alpha.
25785999 current study is the first to demonstrate age-related changes in SIRT1 levels in humans and it is important for a much better molecular understanding of the role of the longevity gene SIRT1 and its protein product in aging
25779952 SIRT1/PGC1alpha-Dependent Increase in Oxidative Phosphorylation Supports Chemotherapy Resistance of Colon Cancer
25773007 SIRT1 -1400 T>C showed risk only in Khatris (p=0.004).
25772107 These findings provide new insights that SirT1 has a profound role in regulating RIBE where a c-Myc-dependent release of ROS may be involved.
25753689 This study showed a novel SIRT1 mediated protection against renal and retinal injury in diabetes, regulated through p300, ET-1 and TGF-beta1.
25737075 The data suggest that Sirt1 contributes to proper and timely microtubule dynamics by regulating the activity of Plk1, which is associated with genomic integrity.
25736100 Hepatic SIRT1 activity was repressed in hepatocellular carcinoma patients with non-B non-C hepatitis.
25734813 SIRT1 gene activation treats aldara induced psoriasis in mouse model.
25730867 SIRT1 signaled through a hypoxia-inducible factor-1 alpha (HIF1alpha)-dependent pathway, orchestrating the reciprocal TH1 and T(reg) lineage commitment through DC-derived IL-12 and TGF-beta1.
25710021 In summary, we found that AGE-BSA induced EndMT in HUVECs via upregulating TGF-beta and downregulating Sirt 1, which also negatively regulated TGF-beta in the cell.
25707573 SIRT1 mRNA was decreased in systemic sclerosis skin samples, and was down-regulated in SSc fibroblasts. Activation attenuated fibrotic response, and inhibition had profibrotic effects.
25706717 Our study provides the first evidence that the tagSNP rs7069102 and haplotype rs7069102G-rs3818292A-rs4746720T in SIRT1 gene confer susceptibility to myocardial infarction in the Chinese Han population.
25696003 The expression of SIRT1 in liver epithelial malignancies, was investigated.
25670865 Ubiquitination of SIRT1 affected its function in cell death and survival in response to DNA damage. Our results suggest that ubiquitination is required for SIRT1 function during DDR
25670718 Higher visfatin/Nampt may prevent a labor-associated decrease in SIRT1 leading to postterm delivery in obesity.
25661920 These results clearly indicate a novel mechanism in which CCAR2 may regulate the transcriptional activation function of LXRalpha due to its specific inhibition of SIRT1 and serve to regulate cellular proliferation.
25652855 MiR-204 inhibits hepatocellular carcinoma cell proliferation and induce apoptosis by down-regulating the expressions of Bcl-2 and Sirt1.
25640014 our work demonstrated that SIRT1 had a pivotally protective role in the regulation of EPCs apoptosis induced by H(2)O(2) and that SIRT1 protected against apoptosis by inhibiting FOXO3a via FOXO3a ubiquitination and subsequent degradation.
25635860 SIRT1 repressed the expression of senescence-associated secretory phenotype factors through the deacetylation of histones in their promoter regions.
25632225 Alisertib cell cycle arrest and promotes autophagic cell death but inhibits EMT in pancreatic cancer cells with the involvement of PI3K/Akt/mTOR, p38 MAPK, Erk1/2, and Sirt1-mediated signaling pathways.
25614674 This review of studies indicate that SIRT1 may play a role in the pathogenesis of skeletal muscle insulin resistance.
25613138 The gene expression of SIRT1 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
25585539 miR-34a increases the sensitivity of colon cancer cells to 5-FU treatment through specific regulation of the SIRT1/p53 pathway.
25582759 Results indicate that statin treatment could produce its protective effect on cardiovascular disease through the inhibition of SIRT1 expression.
25557355 TLX functions as a potent suppressor of oncogene-induced senescence in prostate cancer via its transcriptional co-regulation of the CDKN1A (p21(WAF1) (/) (CIP1) ) and SIRT1 genes
25554355 an association between the SIRT1 gene and schizophrenia in the Chinese Han population, although the effects of the identified haplotype on regional SIRT1 expression and function remain to be determined
25541949 The results show that nitric oxide stabilizes SIRT1 by regulating 26S proteasome functionality through ULK1 and O-linked-GlcNAc transferase, but not autophagy, in endothelial cells.
25529796 NAD(+)-dependent inhibition of SOD2 activity and ROS by SIRT1 provides a gatekeeper function to reduce PARK2-mediated mitophagy and aberrant cell survival
25517228 PARP1-sirtuin 1 functional interplay regulates LPS-mediated HMGB1 secretion
25503852 SIRT1 protects degenerative human nucleus pulposus cells against apoptosis via promoting autophagy.
25500546 High levels of SIRT1 expression enhance tumorigenesis and thus colorectal carcinoma.
25490446 findings identify the BCL6/BCOR/SIRT1 complex as a potent repressor of the SHH pathway in normal and oncogenic neural development.
25483038 Data indicat a strong decrease in the level of sirtuin 1 (SIRT1) protein was observed in samples transfected with microRNAs miR-132 and miR-212 or hSirt1-specific siRNA.
25475438 The current study demonstrates that mice with adipose tissue-selective overexpression of hSIRT1(H363Y), a dominant-negative mutant that disrupts endogenous SIRT1 activity, show accelerated development of metabolic aging.
25463605 Knockdown of SIRT1 by shRNA enhances HIV-1 transactivation in HIV latency condition, suggesting the direct involvement of SIRT1 to HIV latency
25454945 Studies identify the SIRT1-TopBP1 axis as a key signaling mode in the regulation of the metabolic checkpoint and the DNA damage checkpoint.
25445714 The results of this study suggest that PsA is sufficient to overcome multidrug-resistant cancer via SIRT1-mediated autophagy in MCF-7/adr breast cancer cells, indicating that PsA has therapeutic potential for clinical use.
25444742 A role of SIRT1 in cardiovascular system biology and function
25420528 Low expression of SIRT1 or the combined low expression of SIRT1 and high expression of N1IC could be used as indicators of poor prognosis in breast cancer.
25404446 As the nuclear SIRT1 functions as a tumor promoter and cytoplasmic SIRT1 functions as a tumor suppressor, the role of SIRT1 in HCC should be reconsidered.
25389371 S-nitrosylation of SIRT1 may represent a proinflammatory switch common to many diseases and aging
25369635 Sirt1, Sirt2, and Sirt3 can catalyze the hydrolysis of lysine crotonylated histone peptides and proteins.
25361925 This study demonstrated that SIRT1 downregulation in the liver of non-alcoholic fatty liver disease patients.
25360511 Our study demonstrated that piceatannol and its metabolite isorhapontigenin upregulated SIRT1 mRNA and SIRT1 protein in THP-1 monocytic cells.
25358448 Serum SIRT1 might be a novel clinical/biochemical parameter associated with fat liver infiltration
25352462 Findings suggest that aging-associated increase of miR-34a expression levels, by promoting vascular smooth muscle cells senescence and inflammation through SIRT1 downregulation, may lead to arterial dysfunction.
25348016 Induction of differentiation was associated with downregulation of Mt NPM1 and SIRT1.
25347121 p53 activation by inauhzin via inhibiting SIRT1, also inhibits cellular IMPDH2 activity, reduces the levels of cellular GTP and GTP-binding nucleostemin, thus representing in a new anti-cancer strategy.
25342474 Low SIRT1 mRNA expression is associated with acute coronary syndrome.
25341037 SIRT1 and SIRT2 expressions are crucial for the survival of synovial sarcomas and rhabdomyosarcomas.
25323555 The Sirt1 expression level was lower in SAM-P8 than in SAMR1.
25323003 these results highlight a novel interaction between BRCA1 and SIRT1, which may be beneficial for the dynamic balance between BRCA1-related biologic processes and SIRT1-related energy metabolism and stress response.
25305471 The relationship between 19 common single nucleotide polymorphisms of SIRT1 and blood lipids and longeivity are reported.
25304127 review describes the protective effects of SIRT1 and SIRT6 against COPD and their target proteins involved in the pathophysiology of COPD.
25281719 high SIRT1 expression was associated with Ewing sarcoma metastasis and poor prognosis.
25280219 these results identify a c-MYC-related network that enhances SIRT1 protein expression in human FLT3-internal tandem duplication acute myeloid leukemia leukemia stem cells.
25273948 Study demonstrated associations of genetic variations at the SIRT1 and FOXO1 loci with carotid atherosclerosis.
25270091 Knockdown of SIRT1 could downregulate expression of SREBP1 and suppress cell proliferation. These results demonstrated that SIRT1 may play a role as a tumor promoter in EC and can promote endometrial tumor growth by promoting lipogenesis
25252293 This study demonstrates the correlation between the SIRT1 rs144124002 polymorphism and cardiovascular disease in the Turkish population.
25243179 Studied the angiogenic phenotype of our cellular model by inhibiting SIRT1 at both the genetic and pharmacological level.
25233986 first study reporting an association between SIRT1 gene polymorphisms and obesity in children
25228047 This study shows that the cytoplasmic and nuclear SIRT 1 activities are measurable in circulating peripheral blood mononuclear cells of patients with osteoporosis.
25216517 CPEB1 specifically suppressed the translation of HES1 and SIRT1 by interacting with a cytoplasmic polyadenylation element.
25213338 Neurovascular endothelial SIRT1 potentiation upregulates the nitric oxide system and counters cerebral hypoperfusion injury.
25199460 Docosahexaenoic acid may protect against obesity-associated inflammation and colon carcinogenesis by suppressing insulin-induced activation of SREBP-1 and expression of COX-2 through up-regulation of SIRT1.
25193706 GABA protects pancreatic beta cells against apoptosis by increasing SIRT1 expression and activity.
25189993 we have identified JQ-101 as a new SIRT1 inhibitor which may have potential application in cancer treatment through its ability to induce tumor cell apoptosis and senescence and suppress cancer cell invasion.
25180292 Sirt1 regulates canonical TGF-beta signalling to control fibroblast activation and tissue fibrosis.
25172416 MiR-217 inhibitor promoted EMT in PC cells but not in SIRT-knockdown PC cells.
25165029 a new role for SIRT1 in the UVB-induced senescence of skin fibroblats and provides a potential target for skin protection through molecuar insights into the mechanisms responsible for UVB-induced photoaging.
25143434 SIRT1 is a key regulator of p27 protein levels and SIRT1 inhibition is a viable strategy for NSCLC therapy by means of p27 reactivation
25136908 A novel miR-132-sirtuin-1 axis that controls pro-inflammatory cytokine secretion.
25132403 evidence for positive SOX2 regulation by post-translational modification in bone marrow-mesenchymal stem cells through the inhibition of nuclear export and subsequent ubiquitination
25131770 SIRT1 exerted anti-carcinogenic effects via the AMPK-mTOR pathway in HCC in the context of mutant p53.
25119660 Restoration of miR-449 led to suppression of SIRT1 expression and liver tumorigenesis
25116588 NOX2 is involved in the pathogenesis of human emphysema and macrophage-specific NOX2 participates in elastase-induced emphysema through the involvement of sirtuin 1/metalloproteinase-9 pathways in mice
25109285 The induction of Sirt1 and Sirt3 may be a determinant of thyroid cancer cell survival under genotoxic stress conditions. Further examination of the Sirt1-Foxp3 signal may improve our understanding of thyroid carcinogenesis
25096191 Results indicate that expression of SIRT1 in cancer cells with neural stemness plays an important role in suppressing p53-dependent tumor surveillance.
25085245 in vitro and in vivo experiments document that acidosis accounts for a net increase in tumor sensitivity to inhibitors of SIRT1 and glutaminase GLS1
25070626 p53 acts as a molecular switch in monitoring IGF-1-induced proliferation and premature senescence, and suggest a possible molecular connection involving IGF-1-SIRT1-p53 signaling in cellular senescence and aging.
25063737 In this review, SIRT1 is identified as a crucial protective molecule against cardiovascular aging.
25047736 Data suggest SIRT1/AMPK (AMP-activated protein kinase) signaling is involved in regulation of autophagy vs. apoptosis in vascular endothelium in atherosclerosis in response to oxidized low-density lipoprotein and in response to dietary antioxidants.
25040736 Findings suggest that the SIRT1-mediated epigenetic inhibition of PAI-1 expression exerts a protective effect in vascular endothelial senescence.
25032863 SIRT1/SIRT5-mediated PML deacetylation plays a role in the regulation of cancer cell survival.
25024332 miR-181 directly regulates c-Fos and SIRT-1 basal levels in SH-SY5Y cells
24997996 Data highlight the importance of 14-3-3 proteins in antiviral responses and identify RelA-associated inhibitor and sirtuin 1 as novel regulators of antiviral innate immune responses.
24973384 endogenous VSMC SirT1 protein is lost with age and this loss directly contributes to deterioration of cellular function and the induction of cellular senescence.
24969755 Data indicate that ubiquitin specific peptidase 22 (USP22)-mediated sirtuin 1 (SIRT1) deubiquitination inhibits STAT3 transcription factor acetylation and its transcriptional activation.
24962570 SIRT1 supports chondrogenic development of mesenchymal stem cells at least in part through inhibition/deacetylation of NF-kappaB and activation of Sox9.
24924687 MiR132 inhibits expression of SIRT1 and induces pro-inflammatory processes of vascular endothelial inflammation through blockade of the SREBP-1c metabolic pathway
24913149 In advanced heart failure, low Sirt1 expression, like aging change may be a significant contributing factor in the downregulation of antioxidants and upregulation of proapoptotic molecules through the p53, FoxO1, and oxidative stress pathways.
24897117 Frizzled 7 expression is positively regulated by SIRT1 and beta-catenin in breast cancer cells.
24894820 Results suggest that SIRT1 mediates the induction of hBD2 and IL-8 gene expression levels in A549 cell by S. pneumoniae. SIRT1 may play a key role in host immune and defense response in A549.
24892674 There was a negative correlation between miR-221 or miR-222 and SIRT1, but no direct target relationship was identified. These data demonstrate that miR-221 and miR-222 are highly expressed in PC-3 cells.
24890145 SIRT1 overexpression correlated with advanced stage and poor prognosis.
24880091 ERK-5 is required for T cell receptor-induced and oxidative stress-induced full Sirtuin 1 expression
24875419 DNA sequence variants alter the transcriptional activities of SIRT1 gene promoter and change SIRT1 levels, contributing to indirect inguinal hernia development as risk factors.
24875183 this study demonstrates that SIRT1 controls the acetylation level of FOXA2 in a nutrient-dependent manner and in times of nutrient shortage the interaction between SIRT1 and FOXA2 is reduced.
24862934 Cryptosporidium parvum induces SIRT1 expression in host epithelial cells through downregulating let-7i.
24855208 We show that SIRT1 protein, but not RNA levels, is overexpressed in acute myeloid leukemia samples harboring activating mutations in signaling pathways
24850427 Data indicate that SIRT1 is downregulated in IBD patients and colitic mice and suggest that SIRT1 activation can help attenuate inflammatory signals in the gut.
24816737 SIRT1 overexpression was correlated with advanced-stage and poor prognosis in colorectal adenocarcinoma patients.
24751483 impact of SIRT1 on melanoma tumor cell growth and survival through the tumor suppressor p53 and its downstream effector p21
24743044 our study has identified novel insights into SIRT1 signaling in melanoma by connecting this important protein deacetylase with spindle assembly check point proteins BUB3, BUB1 and BUBR1.
24742694 SIRT1 suppression by genetic or pharmacological approaches triggers a cessation of cell proliferation and senescence-like phenotype
24729176 In conclusion, NaHS delays senescence of HUVECs induced by NAM via upregulation of SIRT1 expression.
24726500 Resveratrol inhibited NHEK proliferation by downregulating the expression of AQP3 in an SIRT1/ARNT/ERK dependent fashion.
24726431 These results demonstrate that p53 mutations increase apoptotic resistance in keratinocytes by interfering with miR-34a-mediated regulation of SIRT1 expression.
24702436 Post-transcriptional stabilization of SIRT1 by HuR represses inflammation- and hyperglycaemia-induced E-selectin release and endothelial cell activation.
24681949 Treatment of cells with sirtuin inhibitors, or siRNA knockdown of SIRT1 or SIRT2 proteins, increases MEK1 acetylation and subsequent phosphorylation of the extracellular signal-regulated kinase
24681097 In vitro SIRT1 activity assays disclose AROS as an inhibitor of SIRT1.
24672028 SIRT1 regulates Kaposi's sarcoma-associated herpesvirus (KSHV) latency by inhibiting different stages of viral lytic replication and link the cellular metabolic state with the KSHV life cycle.
24652283 The acetylation of the CTR of S6K1 is inhibited by the class III histone deacetylases, SIRT1 and SIRT2.
24587358 SIRT1 gene polymorphisms affect protein expression in coronary artery disease patients.
24570140 miR-195 regulates SIRT1-mediated tissue damage in diabetic retinopathy
24570024 SIRT1 promoter polymorphisms are clinical modifiers in systemic lupus erythematosus.
24549598 Gestational diabetes mellitus is accompanied by leukocyte PIK3CD overexpression associated with reduced plasma LDL-C and TC levels, as well as with hyperglycaemia and elevated leukocyte SIRT1 mRNA.
24548601 modulates global microRNA maturation in human keratinocytes
24518759 decreased expression of SIRT1 drives accelerated senescence of preterm birth endothelial colony-forming cells (PT-ECFC), and acts as a critical determinant of the PT-ECFC angiogenic defect.
24507186 During neuronal development, the SIR2 promoting axonal elongation, neurite outgrowth, and dendritic branching and may releate to Neurodegenerative Disease.
24504520 This study showed that the expression of miR34a negatively correlates with the expression of CDK4 and MYB and SIRT1 in pediatric patients with acute leukemia.
24489003 The gene expression of SIRT1 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
24488909 FoxM1 positively regulated mRNA expression of Sirt1.
24486702 Methylene blue activates SIRT1, promoting mitochondrial biogenesis and oxygen consumption and activates AMPK, contributing to anti-lipogenesis in the liver.
24486147 results suggest that SIRT1 signaling pathway contributes to protective effect of Des-G against oxidative stress-induced apoptosis
24484175 our results indicated a special role for SIRT1 in the regulation of adaptive response to chemotherapy-induced stress, which is involved in chemoresistance
24473773 SIRT1/macroH2A1.1-dependent epigenetic regulation of lipid metabolism may be relevant to NAFLD development.
24471483 The elevated SIRT1 levels are not due to increased SIRT1 mRNA expression.
24464653 The neuronal subcellular redistribution of SIRT1 in the entorhinal cortex and hippocampus parallels the decrease in its expression during progression of Alzheimer disease.
24451382 glutathione adducts on specific SirT1 thiols may be responsible for dysfunctional SirT1 associated with liver disease in metabolic syndrome
24449278 Data suggest a role for SIRT1 in regulating autophagy and mitochondria function in embryonic stem cells (ESCs) upon oxidative stress.
24434080 fructose inhibits liver fatty acid oxidation by reducing PPARalpha expression and activity, both in rat and human liver cells, by a mechanism involving sirtuin 1 down-regulation
24423936 In the Gal4 reporter systems, Sirt1 was found to repress HIF-1alpha activity constantly in ten cancer cell-lines but to regulate HIF-2alpha activity cell type-dependently.
24419059 our results suggest that capsaicin activated JNK and FOXO-1, leading to the acetylation of FOXO-1 through CBP and SirT-1
24416313 SIRT1 may regulate TERT expression via long-range interaction, or via yet unidentified histone modifications
24414799 The gene expression of SIRT1 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
24410795 propose SIRT1 activation as a novel way of protecting perilesional vitiligo keratinocytes from damage.
24397908 Our data suggest that SIRT1 may represent a biomarker of relapses and a potential new target for therapeutic intervention in MS.
24386389 Myeloid SIRT1 expression does not change mortality in gram-negative toxin-induced shock or gram-positive bacteremia
24383118 SIRT1 mRNA levels are restored in THP-1 monocytic tumor cells following exposure to the antioxidant rosuvastatin.
24378473 Sirt1 may serve as a novel therapeutic target for the treatment of atherosclerosis.
24376725 HCMV infection of endothelial cells induces angiogenesis by both of miR-217/SIRT1 and miR-217/FOXO3A axis
24362520 Authors propose a model for Rac1 activation where SIRT1/2 positively modulates the DVL/TIAM1/Rac1 axis and promotes sustained pathway activation.
24356447 SIRT1 gene expression upon genotoxic damage is regulated by APE1 through negative calcium responsive elements.
24349441 SIRT1 gene is able to complement different molecular phenotypes of the sir2Delta mutant at rDNA
24343700 SIRT1 is strongly expressed in cutaneous T-cell lymphoma (CTCL). Its inhibition results in reduced growth and increased apoptosis of CTCL cells.
24335313 Sirtuin 1 regulates hepatitis B virus transcription and replication by targeting transcription factor AP-1.
24320086 Data suggest that interleukin 8 release from endometrial stromal cells is modulated through SIRT1-mediated signaling in tissue from women with ovarian endometriosis; SIRT1 is expressed in cell nuclei of normal/endometriosic endometrial stromal cells.
24297698 Using cell lines differentially expressing FXRalpha in overexpression and silencing experiments, we demonstrated that SIRT1 activated the core promoter in an FXRalpha- and PGC-1alpha-dependent manner
24270983 autonomic neuropathy in the bone marrow impairs stem cell mobilization in diabetes with dysregulation of the life-span regulators p66Shc and Sirt1
24258275 study demonstrated a cancer-specific role for AROS in the regulation of survival in a panel of human cell lines; data suggest that AROS, as well as SIRT1, promotes survival in cancer cells while being redundant for viability in non-cancer cells
24247792 SIRT1 appears to be a very promising biomarker in the diagnosis of Barrett's esophagus with high-grade dysplasia and carcinoma.
24244526 MicroRNA-142 reduces monoamine oxidase A expression and activity in neuronal cells by downregulating SIRT1.
24228097 SIRT1 is associated with positive regulation of A549 cells migration and SIRT1 is highly expressed in brain metastasis tissues of non-small cell lung cancers.
24223900 Data suggest that the SIRT1 expression may be a molecular marker associated with the non-small cell lung cancer (NSCLC) clinical features, treatment responsiveness and prognosis of advanced NSCLC.
24218438 Several studies suggest that SIRT1 plays a role in myocardial ischemia.
24211575 These results suggest that SIRT1 may deacetylate and promote the ubiquitination and subsequent proteasomal degradation of HIPK2.
24211209 SIRT1 acts as a negative regulator of beta-TrCP synthesis via promoting protein degradation
24184811 SIRT1-mediated activation of FGF21 prevents liver steatosis caused by fasting.
24184155 The role played by SIRT1 and SOST on the abnormal mineralization and Wnt/beta-catenin signaling in osteoarthritic subchondral osteoblast, is reported.
24147777 established that the expression of the ACE2 transcript is controlled by the activity of SIRT1 under conditions of energy stress
24141423 In subjects with diabetes, the levels of SIRT1 and Claudin-1 were correlated with proteinuria levels.
24127549 Sirt1 and H2A.Z deregulation in prostate cancer are related. Epigenetic mechanisms, mostly histone post-translational modifications, are likely involved and impair sirt1-mediated downregulation of H2A.Z via proteasome-mediated degradation.
24126058 MOF acetylation of DBC1 inhibits binding to SirT1 and serves as a mechanism that connects DNA damage signaling to SirT1 and cell fate determination.
24107295 work characterizes SIRT1 status and demonstrates its inhibitory function in gastric cancer development, which involves NF-kappaB/Cyclin D1 signaling
24100623 In the current study, authors showed that the NAD(+)-dependent deacetylase, SIRT1, suppresses ATF4 synthesis during proteasome inhibition.
24088390 High SIRT1 expression is a negative prognosticator in pancreatic ductal adenocarcinoma.
24064760 SIRT1-specific short-interfering RNA was used to investigate the role of SIRT1 in STAT3 signaling
24039251 These results suggest that SIRT1 protects against COPD/emphysema, in part, via redressing the TIMP-1/MMP-9 imbalance involving TIMP-1 deacetylation.
24038750 The importance of Sirt1 in mediating Oct4-dependent pluripotency is revealed by the finding that the ectopic expression of Sirt1 in Oct4-silenced hESCs prevents p53 activation and hESC differentiation.
24035280 These results indicated a possible effect of SIRT1 and p300/CBP involved in regulating the expression of E-cadherin and MLH1, thus participating in the tumor progression of gastroesophageal junction cancer
24019980 demonstrates that SIRT1- and DBC1-related pathways may be involved in the progression of soft-tissue sarcomas and can be used as clinically significant prognostic indicators for sarcoma patients
24018803 This study demonstrates that the acetylation status of P53 and the expression of SIRT1, DBC1, and AR could be new prognostic indicators for clear cell renal cell carcinoma
23993977 Salvianolic acid A mediated protection against concanavalin A-induced hepatitis involves SIRT1 up-regulation.
23977047 Nurr1 overexpression significantly increased the SIRT1 occupancy of the consensus elements for Nurr1 binding hTH promoter region.
23960241 TGF-beta impairs endothelial angiogenic responses partly by downregulating miR-30a-3p and subsequent derepression of MeCP2-mediated epigenetic silencing of Sirt1.
23952905 SIRT1 affects DNA repair through binding to thymine DNA glycosylase (TDG), stimulating TDG glycosylase activity, maintaining TDG in a hypoacetylated state, and regulating TDG expression
23950036 the main actions and molecular pathways triggered by SIRT1 that control feeding behavior, energy expenditure, glucose metabolism, and insulin sensitivity
23933590 The significant association between abdominal visceral fat accumulation and SIRT1 gene expression in PBMCs suggests that SIRT1 may be a new therapeutic target for the prevention of disease related to obesity, especially visceral obesity.
23928404 Endotoxin and tumor necrosis factor-alpha suppressed SIRT1, SIRT3, and SIRT6 expression in human monocytes
23922917 SIRT1 stimulates THRB1 activity in a manner that is independent of PGC-1alpha but requires SIRT1 deacetylase activity.
23900402 In conclusion, this study presented toxoflavin as a potent SIRT1/2 inhibitor with anticancer activity.
23897426 Data indicate that the the nucleomethylin (NML)-SirT1 interaction was competitively inhibited by rRNA.
23892437 Protein acetylation serves as an endogenous regulatory mechanism for SIRT1-DBC1 binding.
23877372 Data indicate that miR-126 directly targets the Sirt1, a member of histone deacetylase, in osteosarcoma cells.
23876548 Adipose tissue SIRT1 may play a key role in the regulation of whole body metabolic homeostasis in humans.
23873758 study indicates that Set7/9 prevents the histone deacetylase activity of SirT1, potentiating euchromatin formation on the promoter site of COL2A1 and resulting in morphology-dependent COL2A1 gene transactivation.
23868084 the p38/SirT1 axis has a role in angiotensin-converting-enzyme inhibition counteracting of angiotensin II-mediated endothelial cell dysfunction
23855981 The deacetylase activity of SIRT1 might play a role in protecting the brain against ischemic injury and in the longevity effects elicited by calorie restriction. (review)
23827175 resistin is a negative regulator of SIRT1 in both human hepatoma cell line HepG2 and mouse hepatocytes.
23814050 resveratrol induces HuR, SIRT1, and MAT2B expression; the last may represent a compensatory response against apoptosis and growth inhibition.
23800577 CR is beneficial for obesity-related metabolic alterations and induces cellular adaptations against aging, possibly through AMPK and SIRT1 activation via circulating factors
23797802 LDH inhibition in Burkitt lymphoma cells led to decreased NAD cellular levels, which resulted in sirtuin-1 inhibition and MYC down-regulation.
23793837 SIRT1 activity is oriented towards nephroprotection in kidney diseases such as diabetic nephropathy. (Review)
23770291 The inhibition of SIRT1 disrupts oxidative energy metabolism and stimulates the NF-kappaB-induced inflammatory responses present in many chronic metabolic and age-related diseases.
23768087 These data demonstrate that miR-204 plays an important role in regulating metastasis of gastric cancer, which is involved in post-transcriptional repression of SIRT1.
23760629 Human cytomegalovirus infection of endothelial cells upregulates miR-199a-5p expression and enhances cell migration and tube formation through downregulation of SIRT1/eNOS by miR-199a-5p.
23754392 Pulsatile shear stress mimicking atheroprotective flow increases the level of SIRT1 in cultured endothelial cells by enhancing its stability, an this effect abolished by inhibition or knockdown of CaMKKbeta.
23728341 miR-29c functions as a tumor suppressor by regulating abnormal SIRT1 activity in liver
23725046 Fasting induces nuclear factor E2-related factor 2 and ATP-binding Cassette transporters via protein kinase A and Sirtuin-1 in mouse and human.
23704280 Study identified a novel pathway that links SIRT1 down-regulation to hypoxia-induced epithelial-to-mesenchymal transition (EMT) in lung cancer cells and may shed light on the development of novel antitumor therapeutics.
23702379 Suggest that SIRT1 and cortactin may play a role in the progression of non-small cell lung cancer and may cooperate during tumor progression in NSCLC.
23673452 the blockade of SIRT1 activity causes an anti-breast cancer cell effect through downregulating the Bcl-2 protein.
23661372 The molecular mechanism by which SIRT1 promotes corneal epithelial wound healing was involved in an enhancement of the IGFBP3/IGF-1/AKT pathway through the deacetylation of p53.
23636469 Chronic consumption of a high-advanced glycation end products diet depletes defenses such as SIRT1 and PPARG.
23613875 Study,has demonstrated the decline in serum concentration of SIRT1 in healthy individuals as they age. In patients with AD and MCI the decline was even more pronounced.
23583951 Knockdown of the NAD(+)-dependent protein deacetylase sirtuin 1 (SIRT1) by siRNA prevented the upregulation of eNOS mRNA and protein by resveratrol.
23561972 These results implied that nicotinamide might be a potential therapeutic agent for human pancreatic cancer treatment through downregulating SIRT1, K-Ras and P-Akt expression.
23548308 This study analyses Sirt1 modulation by several putative Sirt1 regulators, showing that the regulator protein AROS has an unusual conformation and that the Sirt1 catalytic domain is sufficient for modulation by resveratrol.
23547809 The gene expression of SIRT1 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
23542177 findings reveal a new regulatory mechanism of YAP2 by the SIRT1-mediated deacetylation that may be involved in HCC tumorigenesis and drug resistance
23505545 SIRT1 affects human long-term survival and therefore may be an important factor in modulating lifespan not only in lower organisms, but also in humans.
23483263 diminishing the activity of HDACs and SIRT1 was also found to reverse the inhibitory effect of cAMP on the DNA damage-induced p53 stabilization and apoptosis
23477488 Although at its infancy, research on oxidative stress-responsive miRNAs and their regulation of SIRT1 may provide new insights in understanding vascular disorders.
23475622 Downregulation of SIRT1 is associated with head and neck squamous cell carcinoma.
23474493 CBX8 cooperated with SIRT1 for suppressing p53 acetylation induced by Sirtinol and etoposide/TSA. Upon ectopic expression, CBX8 or SIRT1 repressed the expression of p21(WAF1) by inhibiting p53 binding to the promoter.
23473037 Expression of SIRT1 missense mutation (L107P) in insulin-producing cells resulted in overproduction of nitric oxide, cytokines, and chemokines
23453030 SIRT1 expression in aged >65 years, lymph node negative, early clinical stage. positively correlated with expression of acetylated histone H3K9 and H4K16; not with p53. analyses revealed expression of SIRT1 independent indicator of prognosis.
23450480 There is an association between rs4746720 of SIRT1 gene and longevity in Yongfu region of Guangxi.
23449222 This report shows that human Mcm10 is an acetylated protein regulated by SIRT1, which binds and deacetylates Mcm10 both in vivo and in vitro, and modulates Mcm10 stability and ability to bind DNA.
23395904 A previously undescribed SIRT1/Ubc9 regulatory axis in the modulation of protein sumoylation and the hypoxia response.
23394938 The activity of Sirt1 can be controlled by the availability of its substrates, post-translational modifications, interactions with other proteins, or changes in its expression levels.
23390957 SirT1 mediated acetylation/deacetylation and interaction between Kvbeta2 and Kv1.5 in response to incretin in beta cells.
23382833 Monocytic Sirt1 expression is reduced in patients with stable coronary artery disease (CAD), and with acute coronary syndromes
23382074 results indicate an important role of SIRT1-mediated deacetylation in regulating the formation of deubiquitinating module subcomplexes within the larger SAGA complex
23370328 High cytoplasmic Sirtuin-1 regulates acinar-to-ductal metaplasia and supports cancer cell viability in pancreatic cancer.
23365135 Somatic mutation in SIRT1 gene is associated with sporadic form of papillary renal cell carcinoma.
23363613 Sirtuin 1 plays a crucial role in the apoptosis induced by LPS through p53 deacetylation.
23361587 This review of the role of Sirt1 in the onset of kidney disease discusses its possibility as the target of treatment in diabetic nephropathy.
23357110 these results suggest that the regulation of SIRT1 by insulin is important for the neurite outgrowth of neuroblastoma cells.
23354305 Haplotype alleles tagged by the A allele of SIRT1 rs7097008 were associated with increased risk for SCC.
23349863 We found that heat shock results in an increase in the cellular NAD(+)/NADH ratio and an increase in recruitment of SIRT1 to the hsp70 promoter.
23340254 sirtuin-1 (SIRT1), plays a role in positively regulating aromatase in breast cancer.
23332867 The purpose of this study was to use immunohistochemistry to characterize SIRT1 protein expression in human soft tissue neoplasms
23305113 the combination of genetic variation in the SIRT1 gene and dietary n-6 and/or n-3 PUFA intake influence the determination of inter-individual variations of serum levels of LDL-C and HDL-C.
23276927 SirT1 is necessary for healthy cartilage homeostasis and is reduced or inactivated during systemic occurrences involving OA like aging, adipokine release and inflammation[review]
23267107 dysregulation of Sirt1 function that results in transcriptional repression may be the cause of various severe clinical features in patients with XP-D/CS that cannot be explained by a DNA repair defect
23262029 results indicate that MVNP decreases FoxO3/Sirt1 signaling to enhance the levels of IL-6, which in part mediate MVNP's contribution to the development of Paget's disease
23257246 SIRT1 inactivates NF-kappaB, and thereby, exerts an anti-inflammatory effect on human articular chondrocytes.
23255128 Allelic loss or mutations in the SIRT1 gene occur prevalently during tumorigenesis, indicating that SIRT1 may serve as a tumor suppressor.
23248098 SIRT1/S6K-mediated inhibition of autophagy drives prostate tumorigenesis
23247634 Vitamin D significantly reduced the endothelial malfunction and damage caused by oxidative stress, through the activation of MEKs/ERKs/SirT-1 axis.
23247197 SIRT1 inhibition increases Ku70 acetylation, and the acetylated Ku70 with a decreased function mediates the induction of DR5 and the down-regulation of c-FLIP by up-regulating c-Myc/ATF4/CHOP pathway,promotes the TRAIL-induced apoptosis
23238746 Data indicate that knockdown of SIRT1 by RNA interference (RNAi) resulted in increased expression of ICAM-1 in human umbilical vein endothelial cells (HUVECs).
23229445 Sirt1-mediated effects on DNA methylation and, consequently, gene expression may thus be one of the mechanisms underlying the response to dietary restriction.
23224434 The tumor suppressor protein menin inhibits NF-kappaB-mediated transactivation through recruitment of Sirt1 in hepatocellular carcinoma.
23224247 Vascular smooth muscle cell sirtuin 1 protects against DNA damage and inhibits atherosclerosis.
23209300 results indicate that SIRT1 contributes to the T(3) regulation of hepatic genes
23178529 the influence of omentin-1 on two types of human hepatocellular carcinoma cells
23169992 SIRT1 regulates the most important cell signaling pathway for the growth of breast cancer cells, both in the presence and the absence of estrogen.
23153509 The gene expression of SIRT1 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
23143889 overexpression of SIRT1 inhibited IL-1beta-induced expression of cartilage-degrading enzymes in chondrocytes; observations suggest SIRT1 can play a protective role by suppressing IL-1beta-induced expression of cartilage-degrading enzymes partially through modulation of NF-kappaB pathway
23137540 This result suggests that overexpression of SIRT1 or activation of SIRT1 activity attenuates JNK phosphorylation in Hep3B-HBX cells, leading to enhancement of sensitivity to oxidative stress.
23135526 SIRT1 levels appear elevated in human choroidal neovascularization membranes compared with control eyes. Moreover, inhibition of SIRT1 activity is correlated with decreased secretion of potent proangiogenic cytokines.
23133645 The interactive effect of SIRT1 promoter region polymorphism on type 2 diabetes susceptibility in the North Indian population
23103739 The gene expression of SIRT1 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
23079621 these data have identified as novel pathway whereby SIRT1 maintains COL1A2 synthesis in SMCs by modulating RFX5 activity.
23075766 The SIRT1 can inhibit TNF-alpha induced CD40 expression in CRL-1730 endothelial cells by deacetylating the RelA/p65 subunit of NF-kB, which provides new insights into understanding of the anti-inflammatory and anti-athroscerotic actions of SIRT1.
23075334 Studies indicate that SIRT1, SIRT3 and SIRT6 are induced by calorie restriction conditions and are considered anti-aging molecules.
23070058 Data suggest that expression of SIRT1 and PAFR (platelet-activating factor receptor) is down-regulated in endothelial progenitor cells of type 2 diabetic patients with poor glycaemic control compared to those with good glycaemic control.
23056314 VASH1 is a critical factor that improves the stress tolerance of ECs via the induction of SOD2 and SIRT1
23050959 Data suggest that SIRT1 displays differential localization in normal cells and cancer cells, which in turn may affect the substrate specificity for its deacetylase activity. [REVIEW]
23045412 Up-regulation of SIRT1 expression correlates with malignant transformation in the serrated route to colorectal cancer.
23038275 SIRT1 is an important regulator of MMP2 expression, activity, and prostate cancer cell invasion.
23024800 SIRT1 expression supports liver tumorigenesis and is closely correlated with oncogenic c-MYC expression. In addition, both SIRT1 and c-Myc may be useful prognostic indicators of hepatocellular carcinoma.
22995302 SIRT1 inactivation induces inflammation through NF-kappaB activation and dysregulates autophagy via nutrient-sensing pathways such as the mTOR and AMPK pathways, in THP-1 cells.
22990594 SIRT1 plays a critical role in survival of degenerative human NP cells through the Akt anti-apoptotic signaling pathway.
22986747 Findings indicate a role of SIRT1 in response to smoke and a potential role in repressing lung cancer.
22986535 Data indicate that SIRT1 is overexpressed in thyroid cancers and it is positively correlated with c-MYC protein levels.
22980663 SIRT1 maybe effects the atrial fibrillation by means of inhibiting the process of oxidative stress.
22935421 Taken together, the variants identified in myocardial infarction (MI) patients may alter the transcriptional activities of SIRT1 gene promoter, which may change SIRT1 levels, contributing to the MI pathogenesis as a risk factor.
22934845 the roles of SIRT1 in various pathophysiological processes of vascular aging
22902550 Our results support a link between liver cell apoptosis and miR-34a/SIRT1/p53 signaling, specifically modulated by UDCA, and NAFLD severity.
22893703 an enhancement of SIRT1 activity in response to phagocytic stimuli may reduce the accessibility of c-Rel to the il12a promoter and its transcriptional activation, thus regulating the IL-12 p70/IL-23 balance and modulating the ongoing immune response.
22885181 the variants within the SIRT1 gene promoter identified in ventricular septal defects patients may alter the transcriptional activities of SIRT1 gene promoter.
22867969 SIRT1 might be a promoter factor on tumorigenesis of glioma through PTEN/PI3K/AKT signaling pathway.
22836009 As SORL1 (sortilin-related receptor) and SIRT1 (sirtuin 1) genes have been linked to AD pathogenesis, we aimed to investigate their mRNA expression and promoter DNA methylation in post mortem brain tissues from healthy elderly subjects and AD patients
22833338 RSV, at both concentration ranges, leads to a marked increase in p53, while a decrease of SIRT1 expression level.
22824213 Common variants of the SIRT1 gene influence body mass index but not bone mineral density.
22807441 The acetylase/deacetylase couple CREB-binding protein/Sirtuin 1 controls hypoxia-inducible factor 2 signaling.
22796962 SIRT1 expression is activated in postmortem amyotrophic lateral sclerosis tissue and is associated with neuroprotection.
22789853 SIRT1 functions to retain GAPDH in the cytosol, protecting the enzyme from nuclear translocation via interaction with these two proteins.
22780949 these results revealed the novel mechanism that activation and increased expression of SIRT1 play an important role in uterine receptivity.
22773876 a novel role for GATA-4 and TAL1 to affect skeletal myogenic differentiation and EPO response via cross-talk with Sirt1.
22740055 SIRT1 is required in endothelial differentiation of endothelial progenitor cells.
22735644 DBC1 phosphorylation by ATM/ATR inhibits SIRT1 deacetylase in response to DNA damage.
22732402 Overexpression of Tat protein decreases both the deacetylase and promoter activity of SIRT1, (2) SIRT1 inhibition by Tat involves increased levels of acetylated p53 and (3) The activation of p53 leads to subsequent increases in the expression of p53 target genes, p21 and BAX.
22732402 The gene expression of SIRT1 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
22728651 underexpression of AMPK is frequently observed in HCC, and that inactivation of AMPK promotes hepatocarcinogenesis by destabilizing p53 in a SIRT1-dependent manner.
22703651 up-regulated messenger RNA expression of odontoblastic markers as well as angiogenic markers in human dental pulp cells
22700961 in TLR4-stimulated promonocytes SirT1 and SirT 6 support a switch from increased glycolysis to increased fatty acid oxidation as early inflammation converts to late inflammation.
22696478 Data show that Sirt1, p53, and p38(MAPK) are involved in the detrimental phenotype of Max-null ESCs. Analyses revealed these proteins are involved at varying levels to one another in the hierarchy of the pathway leading to cell death in Max-null ESCs.
22689577 Sirt-1 can regulate p53 and NF-kappaB signaling via deacetylation
22683888 the reduction in PPARbeta/delta activity and SIRT1 expression caused by TNF-alpha stimulation through NF-kappaB helps perpetuate the inflammatory process in human adipocytes.
22683003 Data show that LPS-induced SIRT1, IL-17, and IL-23 expression and that IL-17 secretion was attenuated by a SIRT1 inhibitor sirtinol pretreatment.
22674476 Deficiency in carbohydrate intake or excess of fat intake is sufficient to activate the AMPK and SIRT 1 in skeletal muscle.
22661383 Our study provides evidence that expression of SIRT is associated with worse prognosis in triple-negative breast cancer and non-triple-negative breast cancer
22640743 activation of SIRT1 inhibited the proliferation of pancreatic cancer -PAUF cells by down-regulation of cyclin-D1, a target molecule of beta-catenin.
22628222 Berberine upregulated the expression of cellular-survival-associated factor SIRT1 in hepatocytes, thus protecting from apoptosis.
22623155 MiR-34a inhibited Bcl-2 and SIRT1 expression in breast cancer cell.
22613205 these results suggested that genetic variants within the SIRT1 gene promoter may repress SIRT1 gene expression, contributing to PD as a risk factor.
22590959 It regulates the activation of autophagy, which is essential to calorie restricted anti-aging of kidney.
22586264 uncover novel pathways in which SIRT1 dynamically interacts with and regulates hMOF and TIP60 through deacetylation and provide additional mechanistic insights by which SIRT1 regulates DNA damage response
22584570 TDP-43/FMRP/STAU1 specifically binds to the 3'-UTR of SIRT1 mRNA, and that knockdown the expression of any one of these three proteins resulted in the reduction of SIRT1 mRNA and protein.
22564731 SIRT1 ameliorates palmitate-induced insulin resistance in HepG2 cells via regulation of ER stress.
22554968 SIRT1 expression was gradually decreased during the normal-adenoma-adenocarcinoma-metastasis sequence, suggesting a possible role of SIRT1 in tumour suppression in the colorectum, and a probable link to the microsatellite instability pathway.
22553202 Data indicate that an increase in cAMP/PKA activity resulted in the dissociation of SIRT1 and DBC1 in an AMP-activated protein kinase (AMPK)-dependent manner.
22552445 SIRT1 promotes tumorigenesis of hepatocellular carcinoma
22537175 SIRT1 may act as a G1-phase promoter and a survival factor in medulloblastoma cells. SIRT1 expression is correlated with the formation and prognosis of human medulloblastomas.
22510409 these results suggest that HIC1 could be activated upon DNA damages by its SIRT1-mediated deacetylation followed by its subsequent SUMOylation.
22493485 a metabolic state resulting in an elevated [NAD(+)]/[NADH] ratio can modulate mitochondrial quantity and quality via pathways that may include SIRT1-mediated mitochondrial autophagy.
22479397 Data suggest that HIF-1alpha and SIRT1 proteins interact in hepatocellular carcinoma (HCC) cells and that HIF-1alpha is a target of SIRT1 deacetylase activity.
22465953 These results revealed a novel mechanism of SIRT1 regulation during genotoxic stress.
22448750 Findings indicate that SirT1 confers a higher radioresistance in hypoxic cells than in normoxic cells due to the decreased levels of c-Myc protein and its acetylation, and that a c-Myc-dependent radiation-induced phosphorylated p53 may be involved.
22410779 These results reveal a previously unrecognized role of SIRT1 for promoting mutation acquisition in cancer, and have implication for targeting SIRT1 to overcome CML drug resistance.
22406815 These results uncover previously unknown links between Tat and a specific host cell miRNA that targets SIRT1.
22406815 The gene expression of SIRT1 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
22385246 mechanical stress activates human periodontal ligament cells to express immune/defence genes encoding cytokines, chemokines, defensins and TLRs via a SIRT1 pathway.
22378745 Collectively, these findings suggest the existence of a novel reciprocal interaction between AMPK/SIRT1 and p53 that may have implications for the pathogenesis and treatment of metabolic diseases.
22370592 Report increased in SirT1 expression and decreased expression of the Notch signaling effectors in aortic biopsies from patients with bicuspid aortic valves.
22364258 miR-34a may regulate SIRT1 expression.
22363646 ATF4 facilitated multidrug resistance in gastric cancer cells through direct binding to the SIRT1 promoter.
22355666 Loss of SIRT1 results in increased phosphorylation of eIF2alpha. However, the downstream stress induced signaling pathway is compromised in SIRT1-deficient cells, indicated by delayed expression of the downstream target genes CHOP and GADD34.
22340598 SIRT1 knockdown increased apoptosis in LSC of chronic phase and blast crisis chronic myelogenous leukemia (CML) and reduced their growth in vitro and in vivo.
22333659 SIRT1 may play an important role in the development and progression of epithelial tumors of the conjunctiva.
22330808 these findings suggests that the regulation of acetylation of p65 of NF-kappaB through SIRT1 can be a possible target to attenuate cisplatin-induced renal cell damage.
22322739 results suggest that SIRT1 is a crucial antiapoptotic molecule in adult T-cell leukemia-lymphoma cells
22312127 a PIAS4 homologue (zfPIAS4a) from the zebrafish model that shares many conserved structural hallmarks with the human and mammal PIAS4 proteins was successfully identified
22308024 MicroRNA-217 promotes ethanol-induced fat accumulation in hepatocytes by down-regulating SIRT1.
22306819 These results suggest that SIRT1 suppresses differentiation of hematopoietic stem/progenitor cells and contributes to the maintenance of stem cell pool.
22302044 Resveratrol, a SirT1 activator, enhanced the resistance of HepG2 cells against radiation-induced DNA damage of micronucleus formation under hypoxic conditions. Nicotinamide, a SirT1 inhibitor, sensitized this radiation damage.
22272724 Lower Sirt1 in tracheal aspirate leukocytes is associated with the development of bronchopulmonary dysplasia or death in premature infants.
22266962 Oxidative stress reduces placental glucose uptake and GLUT1 expression by a SIRT1-dependent mechanism.
22249256 We therefore identify SIRT1 as a positive regulator of EMT and metastatic growth of prostate cancer cells and our findings implicate overexpressed SIRT1 as a potential therapeutic target to reverse EMT and to prevent prostate cancer progression.
22245592 Polyphenols up-regulated HIF-1alpha and down-regulated c-Myc, PHD2 and beta-catenin expressions via SIRT1 activation, in a manner that mimics hypoxic preconditioning.
22230810 the rs10509291, rs7894483, and rs10823116 alleles were associated with a high BMI (> 23 Kg/m(2)) and with overweight in this non-diabetic Chinese population.
22228742 SIRT1 may be an important genetic factor involved in fetal programming during malnutrition, influencing type 2 diabetes risk later in life.
22219708 SirT1--a sensor for monitoring self-renewal and aging process in retinal stem cells.
22207735 Findings suggest further exploration of SIRT1 as a therapeutic target for chronic myelogenous leukemia (CML) treatment to overcome resistance.
22200427 Sirtuin 1 polymorphisms, rs7069102 and rs2273773, are associated with abnormal cholesterol metabolism and coronary artery calcification in Japanese hemodialysis patients, especially in males
22198152 EX-527, a specific inhibitor of SIRT1, inhibits differentiation of CD34(+) cells. . The nicotinamide effect is SIRT1-specific. SIRT1 has a critical in the regulation of hematopoietic stem cell activity.
22197555 these results indicated that SIRT1 activates hTERT transcription through the involvement of c-MYC, and suggested that this SIRT1-induced augmentation of hTERT transcription resulted in the extension of the cellular life span of HUC-F2 cells.
22190494 c-MYC activates SIRT1, which in turn promotes c-MYC function and suppresses cellular senescence in cells with deregulated c-MYC expression and also inhibits c-MYC-induced apoptosis.
22190034 The gene expression of SIRT1 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
22178470 reviews mechanism and regulation of SIRT1 by environmental agents/oxidants/reactive aldehydes and pro-inflammatory stimuli in lung inflammation and aging; SIRT1 regulates the inflammaging processes involved in DNA damage and repair.
22169038 Both common and rare variations in the SIRT1 gene were shown to be associated with risk of anxiety in human population samples.
22159506 This review summarizes current research in the regulation of SIRT1 signaling in cancer.
22157016 SIRT1 contains N- and C-terminal regions that potentiate deacetylase activity.
22157007 PGAM1 deacetylation and activity are directly controlled by Sirt1.
22152608 Data indicate that SIRT1 appears to play a key role in homeostasis during the human intervertebral disc degeneration process.
22149272 Authors evaluated SIRT1 expression in 19 human colorectal cancer (CRC) specimens and clock gene expression in SIRT1-overexpressing CaCo2 and SW480 cells.
22146883 High SIRT1 Promotes Tumorigenesis and Resistance to Chemotherapy in Hepatocellular Carcinoma
22137654 Increased SIRT1 was identified in different brain regions of SOD1(G93A) transgenic mice, in a model of amyotrophic lateral sclerosis.
22133824 findings show that the senescent phenotypic change is associated with osteoblastic trans-differentiation in smooth muscle cells and mammalian sirtuin SIRT1 (review)
22124156 SIRT1-delta2/9 mRNA was bound by CUGBP2 (which downregulates its translation) and by p53 protein. SIRT1-delta2/9 maintained basal p53 protein levels and suppored p53 function in response to DNA damage.
22121772 Baicalin inhibits oxidative stress-induced apoptosis in SH-SY5Y cells via reducing Caspase-3 expression and up-regulating SIRT1.
22073865 Activation of Sirt1 may protect kidney tubules and be able to apply as a molecular target therapy fo diabetic nephropathy.
22050448 Knockdown of cortactin or silent mating type information regulation 2 homolog 1 expression inhibited both migration and invasion of DU145 prostate cancer cells.
22038097 Knockdown of SIRT1 in human mesenchymal stem cells at early passage slows down cell growth and accelerates cellular senescence.
22017869 found within the C-terminal domain a 25 aa sequence that is essential for Sirt1 activity (ESA). The ESA region interacts with and functions as an "on switch" for the deacetylase core.
22000456 mediates the induction of immune and defense gene expression in human dental pulp cells by lipopolysaccharides and heat stress
21987377 These data suggest that 75SirT1 promotes chondrocyte survival following exposure to proinflammatory cytokines.
21972126 Report SIRT1 impacts age-related decline in telomere length and is associated with longevity.
21968188 CKII downregulation induces p53 stabilization by negatively regulating SIRT1 deacetylase activity during senescence
21956116 The gene expression of SIRT1 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
21947282 SIRT1 deacetylates the DNA methyltransferase 1 (DNMT1) protein and alters its activities
21920899 SIRT1 expression induced by ERalpha was sufficient to activate antioxidant & prosurvival genes in breast cancer cells & to inactivate tumor suppressor genes.
21915620 Data suggest that Sirt1 possibly contributed to autophagy and was involved in pro-survival process mediated by autophagy in multiple myeloma cells under nutrient depletion.
21882241 SIRT1 gene does not contribute to the development of METH-induced psychosis in the Japanese population
21871827 variation in SIRT1 is nominally associated with reduced acute insulin response and increased risk for type 2 diabetes
21865267 SIRT1 expression in gastric cardiac carcinoma was significantly higher than that in normal gastric cardiac tissues.
21852339 SIRT1 single nucleotide polymorphisms were not significantly associated with level or course of lung function, either directly or indirectly via wine or resveratrol intake.
21832856 Studies indicate there are four individual genes shown to impact life span and the aging process: IGF-1, mTOR, sirtuins and klotho.
21813271 Resveratrol decreases hyperglycemic induced superoxide production via up-regulation of SIRT1, induction of FOXO3a and inhibition of p47phox in monocytes.
21810449 Decreased expression of SIRT1 in artery may be involved in the initiation and development of diabetic atherosclerosis. Increasing SIRT1 expression may hold great promise in the prevention and therapy of atherosclerosis in diabetic patients
21807113 Sirt1 deacetylates c-Myc thereby efficiently enhancing c-Myc/Max association in human leukemia cell line K562, suggesting a potential role of Sirt1 in tumorigenesis.
21789216 CBP/p300 and SIRT1 were recruited to histone gene promoters in an NPAT-dependent manner, knockdown of which affected histone acetylation on histone gene promoters and histone gene transcription.
21778425 Endothelium-specific SIRT1 transgenic diabetic mice have decreased p66Shc adaptor protein expression at both mRNA and protein levels.
21775285 The deacetylase SIRT1 promotes membrane localization and activation of Akt and PDK1 during tumorigenesis and cardiac hypertrophy.
21760635 Both, SNPs and SIRT1 gene expression are associated with severe obesity.
21746786 Reductions in SIRT-1 may play an important role in vascular endothelial dysfunction with ageing.
21745208 a potent regulator of differentiation of human periodontal ligament cells and may have clinical implications for periodontal bone regeneration
21720722 SIRT1 is repressed by miR-9 and -181c, either alone or in combination.
21719763 SIRT1 plays an essential role in preventing hyperphosphatemia-induced arterial calcification via inhibition of osteoblastic transdifferentiation
21703114 Depletion of SIRT1 increases the protein stability of EZH2. The regulation of EZH2 protein level by SIRT1 affects the repressive effects of EZH2 on the target gene expression.
21701047 Data show that Sirt1 and Sirt3 act on homologous substrates based on their evolutionary relationship.
21700104 The decreased expression of SirT1 in the lens epithelium was associated with higher cataract scores and patient age and could be a risk factor for the initiation of age-related cataract formation.
21697093 IL-1beta induces dedifferentiation of articular chondrocytes by up-regulation of SIRT1 activity enhanced by both NAMPT and ERK signaling.
21636977 SIRT1 contributes to chromosomal condensation by mediating chromosomal loading of histone H1 and the condensin I complex.
21604001 2-deoxyglucose extends the lifespan of Hs68 cells by increased NAD(+) levels and SIRT1 activities, and has potential as a caloric restriction mimetic.
21596753 a critical tumor suppressive role of the miR-200 family in breast epithelium in addition to identifying a novel regulatory mechanism, which may contribute to SIRT1 up-regulation in breast cancer
21567102 SIRT1 silencing was found to induce cell growth arrest in HCC cells. These results suggest an association of SIRT1 expression with HCC development and that SIRT1 plays a role in cancer cell growth.
21556116 there is a negative correlation between SIRTs 1 and 4 and fasting plasma glucose, a positive correlation between SIRT4 mRNA levels and triglyceride/lipoprotein a levels, and a negative correlation between SIRT4 mRNA levels and HDL
21555002 Results identify an EVI1-SIRT1 axis in the regulation of EVI1 activity suggesting a possible role of SIRT1 in EVI1 positive neoplasms.
21543634 Nuclear SIRT1 activity, but not protein content, regulates mitochondrial biogenesis in rat and human skeletal muscle.
21533107 data support a central role for SIRT1 in the regulation of Foxp3 protein levels and thereby in regulation of Treg suppressive capacity
21527554 Downregulation of SIRT1 consistently suppressed the proliferation of hepatocellular carcinomas cells via the induction of cellular senescence or apoptosis
21505241 crystal diffracted of SIRT1 to 3.4 A resolution and belonged to space group P622, with unit-cell parameters a = b = 203.1, c = 625.3 A, and is estimated to contain between six and 12 molecules per asymmetric unit
21504832 SirT1 preserves heterochromatin structure: it modulates Suv39h1 protein levels in stress conditions by preventing MDM2-mediated polyubiquitination at K87.
21502975 SIRT1, the deacetylase for H4K16Ac, is responsible for deacetylating acetylated hMOF
21502801 The 25% CR diet increased the expression of both SIRT1 and SIRT6 in the ovary.
21501079 The expression of SIRT1 increased in age-related cataract (ARC).
21474819 SIRT1 overexpression substantially inhibits neointima formation in transgenic mice after carotid artery ligation or carotid artery wire injury.
21471201 the inhibition of SIRT1 by mTOR fosters survival of DNA damage-induced prematurely senescent SCC cells via Bfl-1/A1 in the absence of functional p53.
21454709 Sirt1 negatively regulates T cell activation via H3K56 deacetylation at the promoter region to inhibit transcription of Bclaf1
21414717 SIRT1 might play a dual role in different cancer tissue contexts depending on the temporal and special distribution of different SIRT1 upstream and downstream factors [review]
21390332 Knockdown of SIRT1 abolished GR-induced p16 repression as well as Akt/p70S6K1 activation implying that SIRT1 may affect p16 repression through direct deacetylation effects and indirect regulation of Akt/p70S6K1 signaling.
21349544 This study suggested that altered SIRT1, 2 and 6 expression is state-dependent and might be associated with the pathogenesis and/or pathophysiology of mood disorders.
21345792 Hypoxia increases sirtuin 1 expression in a hypoxia-inducible factor-dependent manner
21337390 SIRT1 might play important roles in the pathogenesis of osteoarthritis.
21331741 We identified 4 SNPs in SIRT1 that were nominally associated with diabetic nephropathy, and subsequent haplotype analysis revealed that a haplotype consisting of the 11 SNPs within SIRT1 locus had a stronger association in Japanese type 2 diabetics.
21329659 SIRT1 (Sirtuin 1), a NAD-dependent class III histone deacetylase and a member of the sirtuin family of proteins, partially mediates deacetylation of PXR.
21289058 SIRT1 inhibits FOXL2 transactivation and expression in granulosa cells.
21277951 Using human cells, we show that SIRT1 binds to, and transcriptionally regulates, a gene locus encoding presenilin1
21245319 SIRT1-mediated deacetylation of p53 is abrogated by Set7/9, and p53-mediated transactivation is increased during the DNA damage response
21245135 TLR4 stimulation and human sepsis activate pathways that couple NAD(+) and its sensor SIRT1 with epigenetic reprogramming.
21241768 SIRT1 is a positive modulator of insulin signaling in muscle cells through PI3K
21212262 novel regulatory mechanism involving the phosphorylation of Sirt1 by MST1 kinase which leads to p53 activation, with implications for our understanding of signaling mechanisms during DNA damage-induced apoptosis
21163946 a new role for SIRT1 in the regulation of insulin secretion.
21149730 Data show that inhibition of the deacetylase and longevity factor SIRT1 impairs global genome NER through suppressing the transcription of XPC in a SIRT1 deacetylase-dependent manner.
21149449 Suppression of p53 activity through the cooperative action of Ski and histone deacetylase SIRT1.
21144831 These results suggested that increasing Mash1 and Ngn2 levels by inhibiting Sirt1 could elevate HB9 expression, which promotes motoneuron differentiation.
21130087 Data imply that SIRT1 may mediate MPP(+)-induced cytotoxicity, possibly through the regulation of BNIP2.
21118843 These results provide new insight into SIRT1's anti-atherogenic properties by suppressing Ang II-induced VSMC hypertrophy.
21108727 Both Ku and SIRT1 are induced during restoration of fibroblast replicative senscence and are required for senescent cells to return to a youthful phenotype.
21098725 STAT3-dependent IL-22 signaling and effects in keratinocytes are negatively regulated by SIRT1
21074897 SIRT1 overexpression in an adenoviral vector protects neuronal cells against prion PrP (106-126) fragment-induced cell death.
21067862 miR-34a targeting the Sirt1 and E2F3 genes could negatively regulate the resistance to 5-FU in human colorectal cancer DLD-1 cells.
21056897 Expression of DBC1 and SIRT1 is a significant prognostic indicator for breast carcinoma patients.
20978007 Sirt1 inhibition enhances tissue factor expression and activity by increasing NFkappaB/p65 activation in endothelial cells.
20977650 The SIRT1 gene may play an important role in the pathophysiology of schizophrenia in the Japanese population.
20977650 Observational study of gene-disease association. (HuGE Navigator)
20972425 The findings reveal a novel mechanism for targeted nitrosylation of SIRT1 and suggest that protein-protein transfer of nitric oxide groups may be a general mechanism in cellular signal transduction.
20966076 SIRT1 has roles in the acute and restorative phases following induction of inflammation
20956937 Our results suggest important roles of concomitant upregulation of NAMPT and SIRT1 along with increased FOXO3a protein level for prostate carcinogenesis
20955178 p300 increases the acetylation and protein stability of XBP1s, and enhances its transcriptional activity, whereas SIRT1 deacetylates XBP1s and inhibits its transcriptional activity
20941378 Findings suggest that the over-expressed cytoplasmic SIRT1 in cancer cells may greatly contribute to its cancer-specific function by working downstream of the PI3K/IGF-1R signaling pathway.
20844277 The aim of this study was to characterize the localization and expression of SIRT1 and SIRT2 in placenta and fetal membranes in labor and in response to proinflammaotry stimuli.
20819794 serum-induced SIRT1 expression might reflect the nutritional status of older people rather than being a proximal factor that influences the aging process in older men.
20817729 SIRT1 deacetylates and inhibits SREBP-1C activity in regulation of hepatic lipid metabolism
20813124 NaDC3 promotes cellular senescence probably by inhibiting NAD(+)-dependent SIRT1.
20812964 Sirt1, a putative anti-ageing enzyme, reduced MMP-9 transcriptional expression in skin.
20803525 inhibition of SIRT1 may attenuate HMGB1-mediated periodontal bone resorption through the modulation of osteoclastogenic cytokine levels in human periodontal ligament cells
20733005 VDR associates directly with FoxO proteins and regulators, the sirtuin 1 (Sirt1) class III histone deacetylase (HDAC), and protein phosphatase 1.
20702418 SIRT1 activation by small molecules: kinetic and biophysical evidence for direct interaction of enzyme and activator.
20693263 a common SNP in a novel p53-binding sequence in the human SIRT1 promoter affects nutrient-sensitive SIRT1 expression, and could have a significant impact on calorie restriction-induced, SIRT1-mediated, changes in human metabolism and physiology
20689156 SIRT1 level is regulated by microRNA 34a which is emerging as important metabolic regulator
20670893 SIRT1 regulates NER pathway through modulation of XPA acetylation status.
20668706 SIRT1 deacetylated two specific lysine residues (K265/K268) in PIP5Kgamma and enhanced PIP5Kgamma enzyme activity.
20668205 This study suggested that in the hypothalamus, SIRT1 functions as a key mediator of the central response to low nutritional availability, providing insight into the role of the hypothalamus in the regulation of metabolism and aging in mammals.
20633545 SNP variation in the SIRT1 gene is associated with aging in healthy Chinese population
20633545 Observational study of gene-disease association. (HuGE Navigator)
20631301 show that SIRT1 is down-regulated precisely during human embryonic stem cell differentiation at both mRNA and protein levels
20627091 these data suggest that miR-34a contributes to endothelial senescence through suppression of SIRT1.
20620956 crosstalk between oxygen- and redox-responsive signal transducers occurs through the SIRT1-HIF-1alpha interaction.
20617556 p65/RelA mediates the TNF-alpha-induced elevated expression of SIRT1 in VSMCs, shedding new light on the regulation of SIRT1 under inflammatory conditions.
20555380 Exercise-induced mitochondrial biogenesis is accompanied by elevated SIRT1 activity in human skeletal muscle.
20506278 Data suggest that Nampt/SIRT1 pathway could be a novel therapeutic tool for the treatment of HIV-1 infection.
20506278 The gene expression of SIRT1 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
20503258 Observational study of gene-disease association. (HuGE Navigator)
20493163 the SIRT1-PARP-1 axis plays a critical role in the regulation of cigarette smoke(CS)-induced autophagy and has important implications in understanding the mechanisms of CS-induced cell death and senescence
20488443 Sirt1 plays a key role in the high cellular function of embryonic stem cell and induced pluripotent stem cell derived endothelial cells.
20479254 application of laminar flow increased SIRT1 level and activity, mitochondrial biogenesis, and expression of SIRT1-regulated genes in cultured endothelial cells
20463039 Resveratrol inhibits preadipocyte proliferation and adipogenic differentiation in a Sirt1-dependent manner.
20451257 SNP rs10997875 associated with major depressive disorder in a Japanese population
20451257 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20448046 Peroxisome proliferator-activated receptor gamma co-activator 1alpha (PGC-1alpha) and sirtuin 1 (SIRT1) reside in mitochondria and may have a direct function in mitochondrial biogenesis
20439735 SIRT1 regulates Dishevelled proteins and promotes transient and constitutive Wnt signaling.
20426787 findings suggest that SIRT1 exerts a negative regulatory role in the production of MMP-1 and MMP-3 in human dermal fibroblasts.
20421294 AMPK negatively regulates lipid-induced inflammation, which acts through SIRT1, thereby contributing to the protection against obesity, inflammation, and insulin resistance
20412117 Negative regulation of SIRT1 by DBC1 may retard tumorigenesis in breast tissue, so the correlation between SIRT1 and DBC1 is a potential prognostic indicator in breast cancer.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20335544 Studies of dietary patterns that modify SIRT1 may lead to clinical studies of dietary modification of SIRT1 to influence obesity.
20335544 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20225204 A subcellular distribution pattern of SIRT1 similar to the rat protein is detected in human central nervous system material; SIRT1 is ubiquitously present in areas of the brain especially susceptible to age-related neurodegenerative states.
20217115 Sprint exercise increases SIRT1 protein expression 120 min after a single all-out sprint of only 30 s. This effect was abrogated by the ingestion of 75 g of glucose prior to the sprint.
20203304 SIRT1 and LKB1/AMPK are the 2 key sensor systems for regulating endothelial cell survival, proliferation and senescence.
20167603 DYRK1A and DYRK3 promote cell survival through phosphorylation and activation of SIRT1.
20160399 Predominant role of PPARdelta in the transcriptional regulation of SIRT1 gene via Sp1.
20157519 SIRT1 mediates human papillomavirus E7 survival function in SiHa cervical cancer cells. HPV E7 up-regulates SIRT1 protein when expressed in primary human keratinocytes. SIRT1 levels decrease following RNAi-mediated silencing of HPV E7 in SiHa cells.
20131294 SirT1 is a mediator of human chondrocyte survival via down-regulation of PTP1B, a potent proapoptotic protein that is elevated in osteoarthritis cartilage
20107110 Impaired stimulation of energy expenditure by insulin and low SIRT1 expression in insulin-sensitive tissues is likely to reflect impaired regulation of mitochondrial function associated with insulin resistance in humans.
20103737 we will examine the evidence that AMP-activated protein kinase and SIRT1 both regulate each other and share many common target molecules--REVIEW
20102704 These findings suggest that cigarette smoke - and oxidant-mediated reduction of SIRT1 is associated with acetylation of eNOS which have implications in endothelial dysfunction.
20100829 SIRT1 regulates autoacetylation and histone acetyltransferase activity of TIP60
20089851 Nuclear but not cytoplasmic SIRT1-induced manganese superoxide dismutase (Mn-SOD), which was further enhanced by resveratrol
20071779 New role for DBC1 as an in vivo regulator of SIRT1 activity and liver steatosis, in which interaction with SIRT1 may serve as a new target for therapies aimed at nonalcoholic liver steatosis.
20068143 Insulin resistance and subclinical atherosclerosis are associated with SIRT1 downregulation in monocytes.
20060806 these data suggest that environmental/oxidant stress-induced SIRT1 down-regulation and PARP-1 activation are independent events despite both enzymes sharing the same cofactor.
20041875 Data show that SIRT1 mutation is rare in GC and CRC with MSI, indicating that SIRT1 mutation may not play a significant role in cancer pathogenesis involving MSI.
20033348 Recent studies suggest that SIRT1, a NAD+-dependent deacetylase, protects rats from NAFLD.
20027304 A functional interaction between cJUN N-terminal kinase (JNK1) and SIRT1 was identified by coimmunoprecipitation of endogenous proteins.
19996091 Data demonstrate that Foxp3 is acetylated, and this can be reciprocally regulated by the histone acetyltransferase p300 and the histone deacetylase SIRT1.
19995796 SIRT1, a class III HDAC, regulates ERalpha expression. Inhibition of SIRT1 activity by sirtinol suppresses ERalpha expression through disruption of basal transcriptional complexes at the ERalpha promoter.
19934264 SIRT1 associates with SKI-interacting protein (SKIP) and modulates its activity as a coactivator of retinoic acid receptor.
19923004 Results indicate that Zn(2+) plays a dual role in SIRT1 activity.
19895790 Sirt1 and Tip60 cooperatively regulate DNA damage response signaling and DNA repair by controlling the state of H2AX acetylation.
19887452 IR induces cellular senescence of articular chondrocytes by negative post-translational regulation of SIRT1 via ROS-dependent p38 kinase activation.
19819989 induction of miR-132 decreases SirT1-mediated deacetylation of p65 leading to activation of nuclear factor-kappaB and transcription of IL-8 and MCP-1 in primary human preadipocytes and in vitro differentiated adipocytes
19786632 Inhibition of microRNA-217 in old endothelial cells reduces senescence and increases angiogenic activity via an increase in silent information regulator 1.
19741164 Two common variants in SIRT1 are associated with lower BMI in two independent Dutch populations. Carriers of these variants have 13-18% decreased risk of obesity and gain less weight over time.
19741164 Observational study of gene-disease association. (HuGE Navigator)
19720090 SIRT1 activator resveratrol reversed Tat-mediated reduction in AMP-activated protein kinase activation and downstream acetyl-CoA carboxylase activation.
19720090 The gene expression of SIRT1 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
19716821 SIRT1 can markedly postpone SMC senescence, but this requires overcoming an otherwise vulnerable NAD salvage reaction in aging SMCs
19714620 SIRT1 regulates apoptosis in human chondrocytes through the modulation of mitochondria-related apoptotic signals.
19713122 Sir2/SIRT1 is a key mediator of the beneficial effects of caloric restriction (Review)
19690166 SMILE is a novel corepressor of ERRgamma, and SIRT1 has a role as a novel repressive mechanism for SMILE and ERRgamma inverse agonist
19680556 Observational study of gene-disease association. (HuGE Navigator)
19664641 The gene expression of SIRT1 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
19649206 Our data show the first valid clinical evidence of the deregulation of HIC1-SIRT1-p53 loop in lung tumorigenesis and prognosis
19643082 These findings suggest that an excessive expression of SIRT1 might induce the memory deficit in mice, but not neuroprotective effects.
19581416 In atherosclerotic plaques from subjects with type 2 diabetes, the deregulation of MMP9 activity is related to inadequate expression of TIMP3 via SirT1.
19578370 Data show that MOF acetylates TIP5, the largest subunit of NoRC, at a single lysine residue, K633, adjacent to the TIP5 RNA-binding domain, and that SIRT1 (removes the acetyl group from K633.
19568959 effects of DR relevant to lifespan extension include maintenance of DNA methylation patterns through Sirt1-mediated epigenetic effects, and proffer the view that dietary components, including resveratrol, may mimic these actions.
19555662 TLX is an inducer of SIRT1 and may contribute to neurogenesis both as a transactivator and as a repressor.
19509139 Expression of DBC1 and SIRT1 is a significant prognostic indicator for gastric carcinoma patients.
19498162 findings show that Sirt1 promotes HIF-2 signaling during hypoxia and likely other environmental stresses
19478080 Study found that SIRT1 binds to the promoters of genes commonly regulated by NAMPT, NMNAT-1, and SIRT1 and that SIRT1 histone deacetylase activity is regulated by NAMPT and NMNAT-1 at these promoters.
19433578 pattern is consistent with SirT1 having pleiotropic effects during cancer development (anti-proliferation and anti-apoptotic)
19430421 SIRT1 expression is associated with CIMP-high MSI-high colon cancer, suggesting involvement of SIRT1 in gene silencing in this unique tumor subtype.
19404850 Over-expression of SIRT1 may play an important role in the early stage of ovarian carcinogenesis.
19377286 Sirt1 inhibition resulted in an increase in senescence in PC3-p53 cells whereas it resulted in an increase in apoptosis in PC3 cells
19376817 oxidative stress-dependent reduction of a SIRT1 causes elevation of MMP9 expression
19364925 Results identify a c-Myc-SIRT1 feedback loop in the regulation of c-Myc activity and cellular transformation, supporting/suggesting a role of SIRT1 in tumor suppression.
19343720 results show SIRT1 & SIRT3 are localized in different intracellular compartments, mainly nuclei & mitochondria; identified novel SIRT protein interacting partners which may be critically involved in anti-aging & metabolic regulatory activities of sirtuins
19289152 Studies show that it is likely that Sirt1 affects a number of rhythmic metabolic responses during the course of aging.
19286634 Present a novel mechanism of vascular cell senescence induced by hyperglycemia and suggest a protective role of SIRT1 in the pathogenesis of diabetic vasculopathy.
19285077 SIRT1 regulates tyrosine hydroxylase expression and differentiation of neuroblastoma cells via FOXO3a.
19267881 Serum withdrawal also up-regulates human SIRT1 gene expression in a p53-dependent manner and that the p53-binding element in SIRT1 is required for the up-regulation.
19236849 SIRT1 is a substrate for protein kinase CK2 both in vitro and in vivo.
19229036 results provide a mechanistic basis for the requirement of HSF1 in the regulation of life span and establish a role for SIRT1 in protein homeostasis and the heat shock response
19220062 NAD analogues and 32P-NAD were used to study the ADP-ribosyltransferase activity of several different sirtuins, including yeast Sir2, human SirT1, mouse SirT4, and mouse SirT6.
19188449 The release of PCAF from hSirT1 repression favors the assembly of transcriptionally active PCAF/E2F1 complexes onto the P1p73 promoter and p53-independent apoptosis.
19167483 in subjects with type 2 diabetes, genetic variation influences survival in interaction with dietary niacin and smoking
19167483 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19166820 These results suggest that SirT1 is a potential target for increasing the sensitivity of glioblastoma-associated cancer stem cells to radiotherapy.
19149601 the cellular regulation of SIRT1 expression and activity[Review]
19132007 The seemingly opposite oncogenic and tumour-suppressive effects of SIRT1 depends on the status of p53.
19104446 The results of this study indicate that loss of SIRT1 is closely associated with the accumulation of amyloid-beta and tau in the cerebral cortex of persons with AD.
19075016 inhibition of SIRT1 caused an increase in FOXO1 acetylation and transcriptional activation in PCa cells
19071085 These findings raise the possibility that glucose-induced changes in AMPK are linked to alterations in SIRT1 abundance and activity and possibly cellular redox state.
19060927 the Sirt1-dependent proapoptotic effect of Salermide is p53-independent
19017485 The implications of SIRT1 as a therapeutic target for the optimal balance between anti-aging and anti-cancer activities.
19014491 SIRT1 genetic variants may represent a relevant determinant for the response rate of individuals undergoing caloric restriction and increased physical activity
19014491 Observational study of gene-disease association. (HuGE Navigator)
19008647 A novel chalcone polyphenol inhibits the deacetylase activity of SIRT1 and cell growth in HEK293T cells.
18977241 Observational study of gene-disease association. (HuGE Navigator)
18957417 cartilage-specific gene expression in human chondrocytes is regulated by SirT1 and nicotinamide phosphoribosyltransferase
18922603 To our knowledge, this is the first demonstration of SIRT1 abnormalities, including decreased SIRT1 deacetylase activity, in human disease associated with aging.
18850005 Deacetylation of cortactin is associated with high levels of SIRT1 and tumorigenesis.
18838864 that elevated SIRT1 protein in human cells is not attributable to increased SIRT1 mRNA levels but, instead, reflects SIRT1 protein stability.
18835033 Show that many human cancers exhibit reduced levels of SIRT1 compared to normal controls.
18834855 Reporter assays revealed that miR-34a-induced SIRT1 inhibition occurred at the transcriptional but not post-transcriptional level despite the presence of a potential miR-34a binding site within its 3'-UTR.
18829956 A previously unrecognized role is suggested for brain SIRT1 in regulating energy homeostasis.
18821472 A growing body of evidence suggests a role of SIRT1 in maintaining energy and nutrient homeostasis, thereby linking its anti-aging property to its role in metabolism--REVIEW
18820948 Single nucleotide polymorphism in SIRT1 gene is associated with visceral obesity.
18820948 Observational study of gene-disease association. (HuGE Navigator)
18800364 The gene expression of SIRT1 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
18774777 In this review they outline recent research advances on the regulation of SIRT1 which may provide the basis for the development of therapeutic inhibitors with improved specificity.
18755897 miR-34a functions as a tumor suppressor, in part, through a SIRT1-p53 pathway
18724249 SIRT1 expression is associated with poor prognosis of diffuse large B-cell lymphoma.
18723829 Overexpression of SIRT1 isassociated with cisplatin resistance in cancer cells by altering mitochondrial metabolism.
18704159 During the DNA break, SIRT1 recruits the DNMT3B and causes methylation of the promoter in the silent clones.
18689793 Endothelium-specific overexpression of class III deacetylase SIRT1 decreases atherosclerosis in apolipoprotein E-deficient mice.
18687677 LKB1 deacetylation is regulated by SIRT1 and that this in turn influences its intracellular localization, association with STRAD, kinase activity, and ability to activate AMPK.
18681908 SIRT1 confers protection against UVB- and H2O2-induced cell death via modulation of p53 and JNK in cultured skin keratinocytes
18660489 Observational study of gene-disease association. (HuGE Navigator)
18636124 Observational study of gene-disease association. (HuGE Navigator)
18573234 These results suggest that up-regulation of SIRT1 expression may play an important role in promoting cell growth and chemoresistance in androgen-refractory prostate cancer cells.
18563176 SIRT1 functions in normal human keratinocytes to inhibit proliferation and to promote differentiation
18556572 Cilostazol inhibits oxidative stress-induced premature senescence via upregulation of Sirt1 in human endothelial cells.
18485895 Sirt1 overexpression rescued H(2)O(2)-induced apoptosis through the upregulation of catalase.
18482975 SIRT1 functions as a novel upstream regulator for LKB1/AMP-activated protein kinase signaling and plays an essential role in the regulation of hepatocyte lipid metabolism
18438697 Observational study of gene-disease association. (HuGE Navigator)
18414679 SIRT1 suppresses intestinal tumor formation in vitro
18344999 The gene expression of SIRT1 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
18342601 The gene expression of SIRT1 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
18329615 These results support a model where the normal function of SIRT1 as a negative regulator of T cell activation is suppressed by Tat during HIV infection.
18329615 The gene expression of SIRT1 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
18296641 results suggest that the Sirt1 deacetylase is an important in vivo regulator of autophagy and provide a link between sirtuin function and the overall cellular response to limited nutrients.
18235502 DBC1 (deleted in breast cancer 1) acts as a native inhibitor of SIRT1 in human cells
18235501 DBC1 directly interacts with SIRT1 and inhibits SIRT1 activity in vitro and in vivo
18230337 Our results indicate that nicotinamide treatment attenuates p21WAF1 expression through Sp1 downregulation, and suggest a possible involvement of nicotinamide metabolism in cellular gene expression.
18203716 SIRT1 regulates WRN-mediated cellular responses to DNA damage through deacetylation of WRN.
18184747 Inhibition of SIRT1 in telomerase-immortalized human cells and hematopoietic stem cells obtained from SIRT1-deficient mice enhanced cell growth under normal and nutrient limiting conditions.
18184747 SIRT1 can function as a growth suppressor and regulates AMPK and Telomerase
18174544 SIRT1 plays a pivotal role in regulation of NF-kappaB-dependent proinflammatory mediators in lungs of smokers and patients with COPD.
17996922 SIRT1 protein may be functionally associated with WRN and BLM helicases and that some major SIRT1 functions may not require its deacetylase activity.
17964266 Active regulator of SIRT1 (AROS) is the first direct SIRT1 regulator to be identified that modulates p53-mediated growth regulation.
17937892 Activation of the SIRT1/PGC-1 pathway, in a metabolic context promotes mitochondrial function and this pathway plays a role in neurodegerative disease. Review.
17934453 A novel post-translational sumoylation of SIRT1 at Lys734 increased its deacetylase activity. Stress-inducing agents promoted association of SIRT1 with SENP1 and cells depleted of SENP1 were more resistant to stress-induced apoptosis.
17916362 Sirt1 exerts a protective effects against endothelial dysfunction by preventing stress-induced premature senescence.
17901049 possible regulatory effect of SirT1 on insulin-induced tyrosine phosphorylation of IRS-2, a vital step in insulin signaling pathway, through deacetylation of IRS-2 protein.
17895433 Observational study of gene-disease association. (HuGE Navigator)
17895433 SIRT1 haplotypes were assessed for association with the risks of mortality, metabolic profile, age-related diseases, and cognitive functioning. These analyses revealed a trend for lower cardiovascular mortality for haplotype 2 and rs3758391 SNP carriers.
17806102 Data show that SIRT1 is highly expressed in cancer cell lines as well as in tissue samples from colon carcinoma patients.
17785417 SIRT1 promotes endothelium-dependent vascular relaxation by activating eNOS.
17680780 interaction between Sirt1 and TLE1 is important for mediating repression of NF-kappaB activity
17638871 SIRT1 is significantly elevated in mouse and human prostate cancer
17624472 downregulation of Sirt1 decreases survival and increases radiation-induced antiproliferation effects of human lung cancer cells
17612497 Deacetylation of NBS1 by SIRT1 plays a key role in the dynamic regulation of the DNA damage response and in the maintenance of genomic stability.
17601350 Observational study of gene-disease association. (HuGE Navigator)
17581637 SIRT1 constitutes a unique molecular link between aging and human neurodegenerative disorders and provides a promising avenue for therapeutic intervention
17516504 SIRT1 was distributed in cytoplasm at metaphase during mitosis, and overexpression of SIRT1 significantly augmented apoptosis for cells at metaphase.
17505061 Corepressor of androgen receptor, elucidating a new pathway relevant to prostate cancer growth and approaches to therapy.
17373700 Observational study of gene-disease association. (HuGE Navigator)
17334224 SIRT1 modulates DNA repair activity, which could be regulated by the acetylation status of repair protein Ku70 following DNA damage
17317627 HuR regulates SIRT1 expression, underscore functional links between the two stress-response proteins, and implicate Chk2 in these processes.
17283066 HIC1 is a target of the class III deacetylase SIRT1 and identify a new posttranslational modification step in the P53-HIC1-SIRT1 regulatory loop.
17180656 Overexpression of SIRT1 may have some relevance to the early stage of skin carcinogenesis.
17112576 The association of three Sirt1 SNPs and energy homeostasis in Finnish subjects implicates SIRT1 as a key regulator of energy and metabolic homeostasis.
17099246 In contrast, a SIRT1 inhibitory compound showed a stimulatory activity on the differentiation of adipocytes, a feature often linked to insulin sensitization.
17041012 These data show that SIRT1 regulates cigarette smoke-mediated proinflammatory mediator release via NF-kappaB, implicating a role of SIRT1 in sustained inflammation and aging of the lungs.
17041012 SIRT1 regulates cigarette smoke induced pro-inflammatory mediators release via RelA/p65 NF-{kappa}B in macrophages.
16998810 SIRT1 can modulate p73 activity via deacetylation.
16923962 evidence for an androgen receptor (AR) regulatory pathway controlled by SIRT1; SIRT1 antagonists induce endogenous AR expression and enhance dihydrotestosterone-mediated AR expression
16892051 There is a mutual regulation between E2F1 and SirT1 that affects cellular sensitivity to DNA damage.
16751189 expression of SIRT1 in the brain resulted in decreased ROCK1 expression and elevated alpha-secretase activity; SIRT1 activation in the brain is a novel mechanism through which calorie restriction may influence Alzheimer disease amyloid neuropathology
16628003 AIF-mediated cell death is regulated by the functional interplay of SIRT1 and PARP-1 in response to DNA damage
16385451 Observational study of gene-disease association. (HuGE Navigator)
16354677 Although SIRT1 deacetylates p53, this does not play a role in cell survival following DNA damage in certain cell lines and primary human mammary epithelial cells.
16328012 Data describe the cloning, chromosomal characterization and mapping of the NAD-dependent histone deacetylases gene sirtuin 1.(
16288004 Overexpression of sirt1 induced expression of P-glycoprotein and rendered cancer cells resistant to doxorubicin.
16257164 Observational study of gene-disease association. (HuGE Navigator)
16207712 PARP activation and the concomitant reduction of Sir2alpha activity in failing hearts regulate the post-translational acetylation of p53
16183991 SIRT1 protects against microglia-dependent amyloid-beta toxicity through inhibiting NF-kappaB signaling
16166628 histone deacetylase 4- and SIRT1 deacetylase-mediated lysine modifications regulate MEF2
15749705 binding of resveratrol to SIRT1 promotes a conformational change that accommodates the attached coumarin group
15719057 Hiv Tat is deacetylated by human sirtuin 1 (SIRT1), a nicotinamide adenine dinucleotide-dependent class III protein deacetylase in vitro and in vivo
15719057 The gene expression of SIRT1 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
15692560 FHL2 inhibits FOXO1 activity in prostate cancer cells by promoting the deacetylation of FOXO1 by SIRT1
15640142 substrate recognition by SIRT1 does not depend on the amino acid sequence proximate to the acetylated lysine
15639232 SIRT1 has a role in transcriptional repression mediated by BCL11A in mammalian cells
15632193 SIRT1 deacetylation and repression of p300 involves specific lysine residues in the cell cycle regulatory domain 1
15205477 SIRT1 deacetylates the DNA repair factor Ku70, causing it to sequester the proapoptotic factor Bax away from mitochondria, thereby inhibiting stress-induced apoptotic cell death
15152190 provides evidence that SIRT1 activity augments apoptosis in response to TNFalpha by the ability of the deacetylase to inhibit the transactivation potential of the RelA/p65 protein
15126506 Data demonstrate that acetylation functions in a second pathway of negative control for FOXO factors and provides a novel mechanism whereby hSir2(SIRT1) can promote cellular survival and increase lifespan.
14980222 SIRT1 represses forkhead transcription factors and reduces apoptosis
14976264 SIRT1 and FOXO3 formed a complex in cells in response to oxidative stress; SIRT1 deacetylated FOXO3; SIRT1 increased FOXO3's ability to induce cell cycle arrest and resistance to oxidative stress but inhibited FOXO3's ability to induce cell death
12930829 SIRT1 is a histone H3/H4 deacetylase in mammalian cells and in transcriptional repression mediated by CTIP2
12535671 These results indicate that the molecular association between HES1-, HEY2- and SIRT1-related proteins is conserved among metazoans, from Drosophila to human, and suggest that the Sir2-bHLH interaction also plays important roles in human cells.
12297502 Data show that physiological concentrations of nicotinamide noncompetitively inhibit SIRT1 in vitro.
12006491 the SIRT1 deacetylase as a novel negative regulator of p53 function capable of modulating cellular senescence
11672522 SIRT1(Sir2alpha) deacetylates p53 and promotes survival

AA Sequence

MADEAALALQPGGSPSAAGADREAASSPAGEPLRKRPRRDGPGLERSPGEPGGAAPEREVPAAARGCPGA      1 - 70
AAAALWREAEAEAAAAGGEQEAQATAAAGEGDNGPGLQGPSREPPLADNLYDEDDDDEGEEEEEAAAAAI     71 - 140
GYRDNLLFGDEIITNGFHSCESDEEDRASHASSSDWTPRPRIGPYTFVQQHLMIGTDPRTILKDLLPETI    141 - 210
PPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIY    211 - 280
ARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTL    281 - 350
EQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPE    351 - 420
QFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELC    421 - 490
HRLGGEYAKLCCNPVKLSEITEKPPRTQKELAYLSELPPTPLHVSEDSSSPERTSPPDSSVIVTLLDQAA    491 - 560
KSNDDLDVSESKGCMEEKPQEVQTSRNVESIAEQMENPDLKNVGSSTGEKNERTSVAGTVRKCWPNRVAK    561 - 630
EQISRRLDGNQYLFLPPNRYIFHGAEVYSDSEDDVLSSSSCGSNSDSGTCQSPSLEEPMEDESEIEEFYN    631 - 700
GLEDEPDVPERAGGAGFGTDGDDQEAINEAISVKQEVTDMNYPSNKS                           701 - 747
//

Text Mined References (782)

PMID Year Title
27333745 2016 [SIRT1].
27089876 2016 Common variants in SIRT1 and human longevity in a Chinese population.
26999517 2016 Association between SIRT1 Gene Polymorphisms and Breast Cancer in Egyptians.
26987484 2016 Myeloid deletion of SIRT1 suppresses collagen-induced arthritis in mice by modulating dendritic cell maturation.
26975631 2016 SIRT1 promotes epithelial-mesenchymal transition and metastasis in colorectal cancer by regulating Fra-1 expression.
26896648 2016 Chronic alcohol binging injures the liver and other organs by reducing NAD? levels required for sirtuin's deacetylase activity.
26890260 2016 SIRT1 Disruption in Human Fetal Hepatocytes Leads to Increased Accumulation of Glucose and Lipids.
26831453 2016 Sirt1 and the Mitochondria.
26768367 2016 The epigenetic regulation of HIF-1? by SIRT1 in MPP(+) treated SH-SY5Y cells.
26752489 2016 SIRT1 Inhibits the Catabolic Effect of IL-1? Through TLR2/SIRT1/NF-?B Pathway in Human Degenerative Nucleus Pulposus Cells.
26722524 2015 Expression of Sirt1 and FoxP3 in classical Hodgkin lymphoma and tumor infiltrating lymphocytes: Implications for immune dysregulation, prognosis and potential therapeutic targeting.
26667041 2016 Sirtuins-mediators of maternal obesity-induced complications in offspring?
26656366 2015 Single Nucleotide Polymorphisms of the Sirtuin 1 (SIRT1) Gene are Associated With age-Related Macular Degeneration in Chinese Han Individuals: A Case-Control Pilot Study.
26648302 2015 [Hyperoxia induces reactive oxygen species production and promotes SIRT1 nucleocytoplasmic shuttling of peripheral blood mononuclear cells in premature infants in vitro].
26637398 2015 Association of Genetic Variants of SIRT1 With Type 2 Diabetes Mellitus.
26626483 2015 AMPK-Dependent Phosphorylation of GAPDH Triggers Sirt1 Activation and Is Necessary for Autophagy upon Glucose Starvation.
26619800 2016 HDAC4 mediates IFN-? induced disruption of energy expenditure-related gene expression by repressing SIRT1 transcription in skeletal muscle cells.
26612257 2016 miR-543 promotes gastric cancer cell proliferation by targeting SIRT1.
26601824 2016 Occludin controls HIV transcription in brain pericytes via regulation of SIRT-1 activation.
26585892 2016 Oncogenic role of SIRT1 associated with tumor invasion, lymph node metastasis, and poor disease-free survival in triple negative breast cancer.
26562529 2015 Down-regulation of the miR-543 alleviates insulin resistance through targeting the SIRT1.
26523671 2016 MicroRNA-34a induces a senescence-like change via the down-regulation of SIRT1 and up-regulation of p53 protein in human esophageal squamous cancer cells with a wild-type p53 gene background.
26520405 2015 The plasticizer BBP selectively inhibits epigenetic regulator sirtuins.
26520143 2015 Over-expression of Sirt1 contributes to chemoresistance and indicates poor prognosis in serous epithelial ovarian cancer (EOC).
26509718 2015 SIRT1 Polymorphisms Associate with Seasonal Weight Variation, Depressive Disorders, and Diastolic Blood Pressure in the General Population.
26499802 2015 Endoplasmic Reticulum (ER) Stress Induces Sirtuin 1 (SIRT1) Expression via the PI3K-Akt-GSK3? Signaling Pathway and Promotes Hepatocellular Injury.
26499759 2016 MicroRNA-22 functions as a tumor suppressor by targeting SIRT1 in renal cell carcinoma.
26460121 2015 Upregulation of long non-coding RNA HIF 1?-anti-sense 1 induced by transforming growth factor-?-mediated targeting of sirtuin 1 promotes osteoblastic differentiation of human bone marrow stromal cells.
26443578 2015 Peroxisome Proliferator Activated Receptor-? Association With Silent Information Regulator 1 Suppresses Cardiac Fatty Acid Metabolism in the Failing Heart.
26439987 2015 MicroRNA-212 negatively regulates starvation induced autophagy in prostate cancer cells by inhibiting SIRT1 and is a modulator of angiogenesis and cellular senescence.
26435214 2015 Silent information regulator 1 (SIRT1) ameliorates liver fibrosis via promoting activated stellate cell apoptosis and reversion.
26427145 2015 Sirt1 and HMGB1 Regulate the AGE-Induced Pro-Inflammatory Cytokines in Human Retinal Cells.
26422395 SIRT1 and insulin resistance.
26414199 2016 HDAC4 stabilizes SIRT1 via sumoylation SIRT1 to delay cellular senescence.
26413932 2015 SIRT1 Overexpression Maintains Cell Phenotype and Function of Endothelial Cells Derived from Induced Pluripotent Stem Cells.
26405826 2015 The Deacetylase Sirtuin 1 Regulates Human Papillomavirus Replication by Modulating Histone Acetylation and Recruitment of DNA Damage Factors NBS1 and Rad51 to Viral Genomes.
26398583 2015 SIRT1 downregulation enhances chemosensitivity and survival of adult T-cell leukemia-lymphoma cells by reducing DNA double-strand repair.
26367491 2015 Sirtuin 1 promotes the growth and cisplatin resistance of endometrial carcinoma cells: a novel therapeutic target.
26363315 2015 Repositioning antipsychotic chlorpromazine for treating colorectal cancer by inhibiting sirtuin 1.
26354378 2015 Sirt 1 activator inhibits the AGE-induced apoptosis and p53 acetylation in human vascular endothelial cells.
26352206 2015 Nicotinamide ameliorates palmitate-induced ER stress in hepatocytes via cAMP/PKA/CREB pathway-dependent Sirt1 upregulation.
26345416 2015 Role of SIRT1-mediated mitochondrial and Akt pathways in glioblastoma cell death induced by Cotinus coggygria flavonoid nanoliposomes.
26342525 2016 Sirtuin 1 attenuates nasal polypogenesis by suppressing epithelial-to-mesenchymal transition.
26318035 2015 SIRT1 in B[a]P-induced lung tumorigenesis.
26307266 2015 Resveratrol via sirtuin-1 downregulates RE1-silencing transcription factor (REST) expression preventing PCB-95-induced neuronal cell death.
26284905 2015 The effect of SIRT1 gene polymorphisms on ambulatory blood pressure of hypertensive patients in the Kazakh population.
26284543 2015 VEGF Receptor-2-Linked PI3K/Calpain/SIRT1 Activation Mediates Retinal Arteriolar Dilations to VEGF and Shear Stress.
26280894 2015 Expression of SIRT1 and apoptosis-related proteins is predictive for lymph node metastasis and disease-free survival in luminal A breast cancer.
26238659 2015 Feno?brate suppresses cellular metabolic memory of high glucose in diabetic retinopathy via a sirtuin 1-dependent signalling pathway.
26236947 2015 AMPK inhibits MTDH expression via GSK3? and SIRT1 activation: potential role in triple negative breast cancer cell proliferation.
26233702 2015 Reduced SIRT1 expression correlates with enhanced oxidative stress in compensated and decompensated heart failure.
26225773 2015 SIRT1 is involved in oncogenic signaling mediated by GPER in breast cancer.
26181207 2015 Shear stress regulates endothelial cell autophagy via redox regulation and Sirt1 expression.
26174951 2015 SIRT1 mediated inhibition of VEGF/VEGFR2 signaling by Resveratrol and its relevance to choroidal neovascularization.
26168293 2015 Nicotinamide N-methyltransferase regulates hepatic nutrient metabolism through Sirt1 protein stabilization.
26134520 2015 Crystallographic structure of a small molecule SIRT1 activator-enzyme complex.
26130063 2015 Investigating the role of Sirt1-modulated oxidative stress in relation to benign paroxysmal positional vertigo and Parkinson's disease.
26113041 2016 HIPK2 restricts SIRT1 activity upon severe DNA damage by a phosphorylation-controlled mechanism.
26109180 2015 The effects of resveratrol and SIRT1 activation on dystrophic cardiomyopathy.
26104761 2015 SIRT1 affects DNA methylation of polycomb group protein target genes, a hotspot of the epigenetic shift observed in ageing.
26063426 2015 SIRT1 Suppresses Human T-Cell Leukemia Virus Type 1 Transcription.
26059423 2015 Protective efficacy of carnosic acid against hydrogen peroxide induced oxidative injury in HepG2 cells through the SIRT1 pathway.
26049753 2015 Role of SIRT1 in the growth and regulation of normal hematopoietic and leukemia stem cells.
26049033 2015 SIRT1 is a regulator of autophagy: Implications in gastric cancer progression and treatment.
26036258 2015 The SIRT1/TP53 axis is activated upon B-cell receptor triggering via miR-132 up-regulation in chronic lymphocytic leukemia cells.
26023773 2015 Cooperative Action of Cdk1/cyclin B and SIRT1 Is Required for Mitotic Repression of rRNA Synthesis.
26004371 2015 Distinctive role of SIRT1 expression on tumor invasion and metastasis in breast cancer by molecular subtype.
25998694 2015 MicroRNA-204 inhibits proliferation, migration, invasion and epithelial-mesenchymal transition in osteosarcoma cells via targeting Sirtuin 1.
25982963 2015 Insulin attenuates arsenic-induced neurite outgrowth impairments by activating the PI3K/Akt/SIRT1 signaling pathway.
25982096 2015 Homocysteine facilitates LOX-1 activation and endothelial death through the PKC? and SIRT1/HSF1 mechanism: relevance to human hyperhomocysteinaemia.
25975679 2015 Melatonin reverses H2 O2 -induced premature senescence in mesenchymal stem cells via the SIRT1-dependent pathway.
25972997 2015 Changed profile of microRNAs in acute lung injury induced by cardio-pulmonary bypass and its mechanism involved with SIRT1.
25955819 2015 mTOR, AMPK, and Sirt1: Key Players in Metabolic Stress Management.
25950477 2015 Acetylation of HDAC1 and degradation of SIRT1 form a positive feedback loop to regulate p53 acetylation during heat-shock stress.
25948680 2015 Maternal High-Fat Feeding Increases Placental Lipoprotein Lipase Activity by Reducing SIRT1 Expression in Mice.
25946975 2015 Association of SIRT1 and tumor suppressor gene TAp63 expression in head and neck squamous cell carcinoma.
25926383 2015 Emerging role of silent information regulator 1 (SIRT1) in hepatocellular carcinoma: a potential therapeutic target.
25924011 2015 Resveratrol Induced Premature Senescence Is Associated with DNA Damage Mediated SIRT1 and SIRT2 Down-Regulation.
25922201 2015 SIRT1-related inhibition of pro-inflammatory responses and oxidative stress are involved in the mechanism of nonspecific low back pain relief after exercise through modulation of Toll-like receptor 4.
25915617 2015 Expression of sirtuin 1 and 2 is associated with poor prognosis in non-small cell lung cancer patients.
25905708 2015 KAP1 Deacetylation by SIRT1 Promotes Non-Homologous End-Joining Repair.
25905433 2015 Disruption of Sirtuin 1-Mediated Control of Circadian Molecular Clock and Inflammation in Chronic Obstructive Pulmonary Disease.
25896587 2015 The p53/miR-34a/SIRT1 Positive Feedback Loop in Quercetin-Induced Apoptosis.
25894374 2015 K-Ras promotes the non-small lung cancer cells survival by cooperating with sirtuin 1 and p27 under ROS stimulation.
25890999 2015 Intercellular interplay between Sirt1 signalling and cell metabolism in immune cell biology.
25870236 2015 MPP8 and SIRT1 crosstalk in E-cadherin gene silencing and epithelial-mesenchymal transition.
25847123 2015 SirT1 and STAT3 protect retinal pigmented epithelium cells against oxidative stress.
25829495 2015 Sirtuin Inhibition Induces Apoptosis-like Changes in Platelets and Thrombocytopenia.
25824609 2015 Caloric restriction, resveratrol and melatonin: Role of SIRT1 and implications for aging and related-diseases.
25801465 2015 WRN translocation from nucleolus to nucleoplasm is regulated by SIRT1 and required for DNA repair and the development of chemoresistance.
25799392 2015 Dysregulated serum IL-23 and SIRT1 activity in peripheral blood mononuclear cells of patients with rheumatoid arthritis.
25798752 2015 SIRT1 and circadian gene expression in pancreatic ductal adenocarcinoma: Effect of starvation.
25794641 2015 Expression/localization patterns of sirtuins (SIRT1, SIRT2, and SIRT7) during progression of cervical cancer and effects of sirtuin inhibitors on growth of cervical cancer cells.
25789761 2015 SIRT1/PGC-1? signaling protects hepatocytes against mitochondrial oxidative stress induced by bile acids.
25785999 2015 A remarkable age-related increase in SIRT1 protein expression against oxidative stress in elderly: SIRT1 gene variants and longevity in human.
25779952 2015 SIRT1/PGC1?-Dependent Increase in Oxidative Phosphorylation Supports Chemotherapy Resistance of Colon Cancer.
25773007 2015 The influence of ethnicity in the association of WC, WHR, hypertension and PGC-1? (Gly482Ser), UCP2 -866 G/A and SIRT1 -1400 T/C polymorphisms with T2D in the population of Punjab.
25772107 2015 SirT1 knockdown potentiates radiation-induced bystander effect through promoting c-Myc activity and thus facilitating ROS accumulation.
25753689 2015 SIRT1 reduction causes renal and retinal injury in diabetes through endothelin 1 and transforming growth factor ?1.
25737075 2015 Sirt1 Regulates Microtubule Dynamics Through Negative Regulation of Plk1 in Mitosis.
25736100 2015 Suppression of silent information regulator 1 activity in noncancerous tissues of hepatocellular carcinoma: Possible association with non-B non-C hepatitis pathogenesis.
25734813 2015 SIRT1 Activation Ameliorates Aldara-Induced Psoriasiform Phenotype and Histology in Mice.
25730867 2015 Dendritic cell SIRT1-HIF1? axis programs the differentiation of CD4+ T cells through IL-12 and TGF-?1.
25710021 2015 Advanced glycation end products induce endothelial-to-mesenchymal transition via downregulating Sirt 1 and upregulating TGF-? in human endothelial cells.
25707573 2015 The Histone Deacetylase Sirtuin 1 Is Reduced in Systemic Sclerosis and Abrogates Fibrotic Responses by Targeting Transforming Growth Factor ? Signaling.
25706717 2015 A TagSNP in SIRT1 gene confers susceptibility to myocardial infarction in a Chinese Han population.
25696003 2015 Differential SIRT1 expression in hepatocellular carcinomas and cholangiocarcinoma of the liver.
25670865 2015 Ubiquitinated sirtuin 1 (SIRT1) function is modulated during DNA damage-induced cell death and survival.
25670718 2015 Visfatin/Nampt and SIRT1: Roles in Postterm Delivery in Pregnancies Associated With Obesity.
25661920 2015 CCAR2 negatively regulates nuclear receptor LXR? by competing with SIRT1 deacetylase.
25652855 2015 [Growth inhibition of human hepatocellular carcinoma by miRNA-204 via down-regulation of Bcl-2 and Sirt1 expression].
25640014 2015 SIRT1 Protects Against Oxidative Stress-Induced Endothelial Progenitor Cells Apoptosis by Inhibiting FOXO3a via FOXO3a Ubiquitination and Degradation.
25635860 2015 SIRT1 suppresses the senescence-associated secretory phenotype through epigenetic gene regulation.
25632225 2015 Alisertib induces cell cycle arrest and autophagy and suppresses epithelial-to-mesenchymal transition involving PI3K/Akt/mTOR and sirtuin 1-mediated signaling pathways in human pancreatic cancer cells.
25614674 2015 [The role of SIRT1 in the pathogenesis of insulin resistance in skeletal muscle].
25585539 2015 MiR-34a inhibits migration and invasion by regulating the SIRT1/p53 pathway in human SW480 cells.
25582759 2015 Efficacy of statins on sirtuin 1 and endothelial nitric oxide synthase expression: the role of sirtuin 1 gene variants in human coronary atherosclerosis.
25557355 2015 Orphan nuclear receptor TLX functions as a potent suppressor of oncogene-induced senescence in prostate cancer via its transcriptional co-regulation of the CDKN1A (p21(WAF1) (/) (CIP1) ) and SIRT1 genes.
25554355 2015 Association between Silent Information Regulator 1 (SIRT1) gene polymorphisms and schizophrenia in a Chinese Han population.
25541949 2014 Upregulation of Unc-51-like kinase 1 by nitric oxide stabilizes SIRT1, independent of autophagy.
25529796 2015 Loss of Sirt1 promotes prostatic intraepithelial neoplasia, reduces mitophagy, and delays PARK2 translocation to mitochondria.
25517228 2015 Poly(ADP-ribose) polymerase 1-sirtuin 1 functional interplay regulates LPS-mediated high mobility group box 1 secretion.
25503852 2014 SIRT1 protects against apoptosis by promoting autophagy in degenerative human disc nucleus pulposus cells.
25500546 2014 High levels of SIRT1 expression enhance tumorigenesis and associate with a poor prognosis of colorectal carcinoma patients.
25490446 2014 A BCL6/BCOR/SIRT1 complex triggers neurogenesis and suppresses medulloblastoma by repressing Sonic Hedgehog signaling.
25483038 2014 Comprehensive silencing of target-sharing microRNAs is a mechanism for SIRT1 overexpression in cancer.
25475438 2015 Calorie Restriction Prevents Metabolic Aging Caused by Abnormal SIRT1 Function in Adipose Tissues.
25454945 2014 A divergent role of the SIRT1-TopBP1 axis in regulating metabolic checkpoint and DNA damage checkpoint.
25445714 2015 Psammaplin A induces Sirtuin 1-dependent autophagic cell death in doxorubicin-resistant MCF-7/adr human breast cancer cells and xenografts.
25444742 2015 SIRT1: role in cardiovascular biology.
25420528 2014 Correlation and prognostic value of SIRT1 and Notch1 signaling in breast cancer.
25406032 2014 Modification of DBC1 by SUMO2/3 is crucial for p53-mediated apoptosis in response to DNA damage.
25404446 2014 Prognostic role of SIRT1 in hepatocellular carcinoma.
25389371 2014 Inflammatory stimuli induce inhibitory S-nitrosylation of the deacetylase SIRT1 to increase acetylation and activation of p53 and p65.
25369635 2014 Identification of 'erasers' for lysine crotonylated histone marks using a chemical proteomics approach.
25361978 2014 Chk2 and REG?-dependent DBC1 regulation in DNA damage induced apoptosis.
25361925 2014 Direct evidence of sirtuin downregulation in the liver of non-alcoholic fatty liver disease patients.
25360511 2014 Piceatannol and its metabolite, isorhapontigenin, induce SIRT1 expression in THP-1 human monocytic cell line.
25358448 2015 Plasma levels of SIRT1 associate with non-alcoholic fatty liver disease in obese patients.
25352462 2015 MicroRNA-34a Induces Vascular Smooth Muscle Cells Senescence by SIRT1 Downregulation and Promotes the Expression of Age-Associated Pro-inflammatory Secretory Factors.
25348016 2014 Nontoxic-dose of deguelin induce NPMc+ AML cell differentiation by selectively targeting Mt NPM1/SIRT1 instead of HDAC1/3.
25347121 2014 The role of IMP dehydrogenase 2 in Inauhzin-induced ribosomal stress.
25342474 2015 Association between the SIRT1 mRNA expression and acute coronary syndrome.
25341037 2014 SIRT1 and SIRT2 inhibition impairs pediatric soft tissue sarcoma growth.
25323555 2014 Age-dependent tissue expression patterns of Sirt1 in senescence-accelerated mice.
25323003 2014 A novel crosstalk between BRCA1 and sirtuin 1 in ovarian cancer.
25305471 2015 Genetic variation in Sirtuin 1 (SIRT1) is associated with lipid profiles but not with longevity in Ashkenazi Jews.
25304127 2015 Role of sirtuins in chronic obstructive pulmonary disease.
25281719 2014 Suppression of deacetylase SIRT1 mediates tumor-suppressive NOTCH response and offers a novel treatment option in metastatic Ewing sarcoma.
25280219 2014 SIRT1 activation by a c-MYC oncogenic network promotes the maintenance and drug resistance of human FLT3-ITD acute myeloid leukemia stem cells.
25273948 2014 Genetic polymorphisms at SIRT1 and FOXO1 are associated with carotid atherosclerosis in the SAPHIR cohort.
25270091 2014 SIRT1 promotes endometrial tumor growth by targeting SREBP1 and lipogenesis.
25252293 2015 The effect of the SIRT1 2827 A>G polymorphism, resveratrol, exercise, age and occupation in Turkish population with cardiovascular disease.
25243179 2014 SIRT1 inhibition affects angiogenic properties of human MSCs.
25233986 2015 SIRT1 gene variants are related to risk of childhood obesity.
25228047 2014 Sirtuin 1 activity in peripheral blood mononuclear cells of patients with osteoporosis.
25216517 2014 CPEB1 modulates differentiation of glioma stem cells via downregulation of HES1 and SIRT1 expression.
25213338 2014 Silent information regulator 2 homolog 1 counters cerebral hypoperfusion injury by deacetylating endothelial nitric oxide synthase.
25199460 2014 Docosahexaenoic acid inhibits insulin-induced activation of sterol regulatory-element binding protein 1 and cyclooxygenase-2 expression through upregulation of SIRT1 in human colon epithelial cells.
25193706 2014 GABA protects pancreatic beta cells against apoptosis by increasing SIRT1 expression and activity.
25189993 2014 Identification of a novel polyprenylated acylphloroglucinol?derived SIRT1 inhibitor with cancer?specific anti-proliferative and invasion-suppressing activities.
25180292 2016 Sirt1 regulates canonical TGF-? signalling to control fibroblast activation and tissue fibrosis.
25172416 2014 Chronic pancreatitis and pancreatic cancer demonstrate active epithelial-mesenchymal transition profile, regulated by miR-217-SIRT1 pathway.
25165029 2015 Molecular Insights into SIRT1 Protection Against UVB-Induced Skin Fibroblast Senescence by Suppression of Oxidative Stress and p53 Acetylation.
25143434 2015 SIRT1 inactivation evokes antitumor activities in NSCLC through the tumor suppressor p27.
25136908 2014 A novel microRNA-132-sirtuin-1 axis underlies aberrant B-cell cytokine regulation in patients with relapsing-remitting multiple sclerosis [corrected].
25132403 2014 SIRT1 directly regulates SOX2 to maintain self-renewal and multipotency in bone marrow-derived mesenchymal stem cells.
25131770 2015 SIRT1 regulates oncogenesis via a mutant p53-dependent pathway in hepatocellular carcinoma.
25119660 2014 MicroRNA-449 suppresses proliferation of hepatoma cell lines through blockade lipid metabolic pathway related to SIRT1.
25116588 2015 Macrophage-specific NOX2 contributes to the development of lung emphysema through modulation of SIRT1/MMP-9 pathways.
25109285 2014 Sirt1 induction confers resistance to etoposide-induced genotoxic apoptosis in thyroid cancers.
25096191 2015 SIRT1 is required for oncogenic transformation of neural stem cells and for the survival of "cancer cells with neural stemness" in a p53-dependent manner.
25085245 2014 The SIRT1/HIF2? axis drives reductive glutamine metabolism under chronic acidosis and alters tumor response to therapy.
25070626 2014 Insulin-like growth factor-1 regulates the SIRT1-p53 pathway in cellular senescence.
25063737 2014 SIRT1 in cardiovascular aging.
25047736 2014 Delphinidin-3-glucoside protects human umbilical vein endothelial cells against oxidized low-density lipoprotein-induced injury by autophagy upregulation via the AMPK/SIRT1 signaling pathway.
25040736 2014 SIRT1-mediated epigenetic downregulation of plasminogen activator inhibitor-1 prevents vascular endothelial replicative senescence.
25032863 2014 Deacetylation of the tumor suppressor protein PML regulates hydrogen peroxide-induced cell death.
25024332 2014 Upregulation of miR-181 decreases c-Fos and SIRT-1 in the hippocampus of 3xTg-AD mice.
24997996 2014 Phosphoproteomics combined with quantitative 14-3-3-affinity capture identifies SIRT1 and RAI as novel regulators of cytosolic double-stranded RNA recognition pathway.
24973384 2014 Age-related loss of SirT1 expression results in dysregulated human vascular smooth muscle cell function.
24969755 2014 Ubiquitin-specific peptidase USP22 negatively regulates the STAT signaling pathway by deubiquitinating SIRT1.
24962570 2014 Sirtuin-1 (SIRT1) is required for promoting chondrogenic differentiation of mesenchymal stem cells.
24924687 2014 MiR-132 inhibits expression of SIRT1 and induces pro-inflammatory processes of vascular endothelial inflammation through blockade of the SREBP-1c metabolic pathway.
24913149 2014 Downregulation of Sirt1 as aging change in advanced heart failure.
24897117 2014 Frizzled 7 expression is positively regulated by SIRT1 and ?-catenin in breast cancer cells.
24894820 2014 Role of SIRT1 in Streptococcus pneumoniae-induced human ?-defensin-2 and interleukin-8 expression in A549 cell.
24892674 2014 Down-regulation of mir-221 and mir-222 restrain prostate cancer cell proliferation and migration that is partly mediated by activation of SIRT1.
24890145 2014 Overexpression of SIRT1 is a poor prognostic factor for advanced colorectal cancer.
24880091 2014 Extracellular-signal-regulated kinase 5 modulates the antioxidant response by transcriptionally controlling Sirtuin 1 expression in leukemic cells.
24877878 2014 Sirtuins: guardians of mammalian healthspan.
24875419 2014 Functional sequence variants within the SIRT1 gene promoter in indirect inguinal hernia.
24875183 2014 SIRT1 mediates FOXA2 breakdown by deacetylation in a nutrient-dependent manner.
24862934 2014 Cryptosporidium parvum induces SIRT1 expression in host epithelial cells through downregulating let-7i.
24855208 2014 SIRT1 prevents genotoxic stress-induced p53 activation in acute myeloid leukemia.
24850427 2014 Defective expression of SIRT1 contributes to sustain inflammatory pathways in the gut.
24824780 2015 MCC inhibits beta-catenin transcriptional activity by sequestering DBC1 in the cytoplasm.
24816737 2014 Clinicopathological significance of SIRT1 expression in colorectal adenocarcinoma.
24751483 2014 SIRT1 deacetylase is overexpressed in human melanoma and its small molecule inhibition imparts anti-proliferative response via p53 activation.
24743044 2014 Novel downstream molecular targets of SIRT1 in melanoma: a quantitative proteomics approach.
24742694 2014 SIRT1 promotes proliferation and inhibits the senescence-like phenotype in human melanoma cells.
24729176 2014 Hydrogen sulfide delays nicotinamide-induced premature senescence via upregulation of SIRT1 in human umbilical vein endothelial cells.
24726500 2014 Resveratrol inhibition of human keratinocyte proliferation via SIRT1/ARNT/ERK dependent downregulation of aquaporin 3.
24726431 2014 SIRT1 inhibition restores apoptotic sensitivity in p53-mutated human keratinocytes.
24702436 2014 Sirtuin 1 stabilization by HuR represses TNF-?- and glucose-induced E-selectin release and endothelial cell adhesiveness in vitro: relevance to human metabolic syndrome.
24681949 2015 Regulation of the mitogen-activated protein kinase kinase (MEK)-1 by NAD(+)-dependent deacetylases.
24681097 2014 AROS has a context-dependent effect on SIRT1.
24672028 2014 Activation of Kaposi's sarcoma-associated herpesvirus (KSHV) by inhibitors of class III histone deacetylases: identification of sirtuin 1 as a regulator of the KSHV life cycle.
24652283 2014 Cross-talk between sirtuin and mammalian target of rapamycin complex 1 (mTORC1) signaling in the regulation of S6 kinase 1 (S6K1) phosphorylation.
24587358 2014 SIRT1 gene polymorphisms affect the protein expression in cardiovascular diseases.
24570140 2014 miR-195 regulates SIRT1-mediated changes in diabetic retinopathy.
24570024 2014 SIRT1 promoter polymorphisms as clinical modifiers on systemic lupus erythematosus.
24549598 2014 The association of leukocyte phosphatidylinositol 3-kinase delta overexpression with gestational diabetes mellitus (GDM).
24548601 2014 SIRT1 modulates miRNA processing defects in p53-mutated human keratinocytes.
24518759 2014 Accelerated senescence of cord blood endothelial progenitor cells in premature neonates is driven by SIRT1 decreased expression.
24507186 2014 SIRT1 in neurodevelopment and brain senescence.
24504520 2014 A correlation analysis of miRNA?34a and its predicted target genes in leukemia.
24488909 2014 FoxM1 regulates Sirt1 expression in glioma cells.
24486702 2014 SIRT1 activation by methylene blue, a repurposed drug, leads to AMPK-mediated inhibition of steatosis and steatohepatitis.
24486147 2014 Des-acyl ghrelin protects microvascular endothelial cells from oxidative stress-induced apoptosis through sirtuin 1 signaling pathway.
24484175 2014 Sirtuin 1 facilitates chemoresistance of pancreatic cancer cells by regulating adaptive response to chemotherapy-induced stress.
24473773 2014 SIRT1-metabolite binding histone macroH2A1.1 protects hepatocytes against lipid accumulation.
24471483 2014 Calorie restriction upregulated sirtuin 1 by attenuating its ubiquitin degradation in cancer cells.
24464653 2014 Distinct patterns of sirtuin expression during progression of Alzheimer's disease.
24451382 2014 A redox-resistant sirtuin-1 mutant protects against hepatic metabolic and oxidant stress.
24449278 2014 SIRT1 positively regulates autophagy and mitochondria function in embryonic stem cells under oxidative stress.
24434080 2014 Liquid fructose downregulates Sirt1 expression and activity and impairs the oxidation of fatty acids in rat and human liver cells.
24423936 2014 Differential roles of Sirt1 in HIF-1? and HIF-2? mediated hypoxic responses.
24419059 2014 CBP-mediated FOXO-1 acetylation inhibits pancreatic tumor growth by targeting SirT.
24416313 2014 Depletion of sirtuin 1 (SIRT1) leads to epigenetic modifications of telomerase (TERT) gene in hepatocellular carcinoma cells.
24415752 2014 Deleted in breast cancer 1 (DBC1) protein regulates hepatic gluconeogenesis.
24410795 2014 SIRT1 regulates MAPK pathways in vitiligo skin: insight into the molecular pathways of cell survival.
24397908 2014 SIRT1 is decreased during relapses in patients with multiple sclerosis.
24386389 2013 Myeloid cell sirtuin-1 expression does not alter host immune responses to Gram-negative endotoxemia or Gram-positive bacterial infection.
24383118 2013 Rosuvastatin restores advanced glycation end product-induced decrease in sirtuin 1 (SIRT1) mRNA levels in THP-1 monocytic cells through its anti-oxidative properties.
24378473 2014 Enhancement in efferocytosis of oxidized low-density lipoprotein-induced apoptotic RAW264.7 cells through Sirt1-mediated autophagy.
24376725 2013 MicroRNA-217 promotes angiogenesis of human cytomegalovirus-infected endothelial cells through downregulation of SIRT1 and FOXO3A.
24362520 2015 The sirtuins promote Dishevelled-1 scaffolding of TIAM1, Rac activation and cell migration.
24356447 2014 SIRT1 gene expression upon genotoxic damage is regulated by APE1 through nCaRE-promoter elements.
24349441 2013 Functional complementation of sir2? yeast mutation by the human orthologous gene SIRT1.
24343700 2014 SIRT1 is upregulated in cutaneous T-cell lymphoma, and its inhibition induces growth arrest and apoptosis.
24335313 2014 Sirtuin 1 regulates hepatitis B virus transcription and replication by targeting transcription factor AP-1.
24320086 2014 Resveratrol suppresses inflammatory responses in endometrial stromal cells derived from endometriosis: a possible role of the sirtuin 1 pathway.
24297698 2014 The metabolic sensors FXR?, PGC-1?, and SIRT1 cooperatively regulate hepatitis B virus transcription.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24270983 2014 Diabetes causes bone marrow autonomic neuropathy and impairs stem cell mobilization via dysregulated p66Shc and Sirt1.
24258275 2013 Active regulator of SIRT1 is required for cancer cell survival but not for SIRT1 activity.
24247792 2013 SIRT1 is a useful biomarker for high-grade dysplasia and carcinoma in Barrett's esophagus.
24244526 2013 MicroRNA-142 reduces monoamine oxidase A expression and activity in neuronal cells by downregulating SIRT1.
24228097 2013 SIRT1 is highly expressed in brain metastasis tissues of non-small cell lung cancer (NSCLC) and in positive regulation of NSCLC cell migration.
24223900 2013 SIRT1 expression is associated with the chemotherapy response and prognosis of patients with advanced NSCLC.
24218438 2013 Novel role of silent information regulator 1 in myocardial ischemia.
24211575 2013 SIRT1 negatively regulates the protein stability of HIPK2.
24211209 2013 SIRT1 suppresses cellular accumulation of ?-TrCP E3 ligase via protein degradation.
24184811 2014 Hepatic SIRT1 attenuates hepatic steatosis and controls energy balance in mice by inducing fibroblast growth factor 21.
24184155 2014 Low sirtuin 1 levels in human osteoarthritis subchondral osteoblasts lead to abnormal sclerostin expression which decreases Wnt/?-catenin activity.
24147777 2014 Epigenetic regulation of angiotensin-converting enzyme 2 (ACE2) by SIRT1 under conditions of cell energy stress.
24141423 2013 Renal tubular Sirt1 attenuates diabetic albuminuria by epigenetically suppressing Claudin-1 overexpression in podocytes.
24127549 2013 Regulation of histone H2A.Z expression is mediated by sirtuin 1 in prostate cancer.
24126058 2013 hMOF acetylation of DBC1/CCAR2 prevents binding and inhibition of SirT1.
24107295 2013 SIRT1 is downregulated in gastric cancer and leads to G1-phase arrest via NF-?B/Cyclin D1 signaling.
24100623 2013 SIRT1 suppresses activating transcription factor 4 (ATF4) expression in response to proteasome inhibition.
24088390 2013 High SIRT1 expression is a negative prognosticator in pancreatic ductal adenocarcinoma.
24064760 2013 Resveratrol suppresses the STAT3 signaling pathway and inhibits proliferation of high glucose-exposed HepG2 cells partly through SIRT1.
24048733 2013 Antidicer RNAse activity of monocyte chemotactic protein-induced protein-1 is critical for inducing angiogenesis.
24043310 2013 SIRT4 represses peroxisome proliferator-activated receptor ? activity to suppress hepatic fat oxidation.
24039251 2013 SIRT1 redresses the imbalance of tissue inhibitor of matrix metalloproteinase-1 and matrix metalloproteinase-9 in the development of mouse emphysema and human COPD.
24038750 2014 Oct4 maintains the pluripotency of human embryonic stem cells by inactivating p53 through Sirt1-mediated deacetylation.
24035280 2013 Clinicopathological significance of SIRT1 and p300/CBP expression in gastroesophageal junction (GEJ) cancer and the correlation with E-cadherin and MLH1.
24019980 2013 Expression of SIRT1 and DBC1 is associated with poor prognosis of soft tissue sarcomas.
24018803 2013 Acetylation status of P53 and the expression of DBC1, SIRT1, and androgen receptor are associated with survival in clear cell renal cell carcinoma patients.
23993977 2013 Salvianolic acid A preconditioning confers protection against concanavalin A-induced liver injury through SIRT1-mediated repression of p66shc in mice.
23977047 2013 Nurr1 represses tyrosine hydroxylase expression via SIRT1 in human neural stem cells.
23960241 2013 MicroRNA-mediated epigenetic silencing of sirtuin1 contributes to impaired angiogenic responses.
23952905 2013 Histone deacetylase SIRT1 modulates and deacetylates DNA base excision repair enzyme thymine DNA glycosylase.
23950036 2013 The brain: a new organ for the metabolic actions of SIRT1.
23933590 2013 Visceral adiposity is associated with SIRT1 expression in peripheral blood mononuclear cells: a pilot study.
23928404 2013 Adipose tissue and liver expression of SIRT1, 3, and 6 increase after extensive weight loss in morbid obesity.
23922917 2013 SIRT1 is a direct coactivator of thyroid hormone receptor ?1 with gene-specific actions.
23900402 2013 Discovery of a potent small molecule SIRT1/2 inhibitor with anticancer effects.
23897426 2013 Regulation of SirT1-nucleomethylin binding by rRNA coordinates ribosome biogenesis with nutrient availability.
23892437 2013 Carboxamide SIRT1 inhibitors block DBC1 binding via an acetylation-independent mechanism.
23877372 2013 MicroRNA-126 inhibits osteosarcoma cells proliferation by targeting Sirt1.
23876548 2013 Association between low SIRT1 expression in visceral and subcutaneous adipose tissues and metabolic abnormalities in women with obesity and type 2 diabetes.
23873758 2014 Set7/9 impacts COL2A1 expression through binding and repression of SirT1 histone deacetylation.
23868084 2013 Angiotensin-converting-enzyme inhibition counteracts angiotensin II-mediated endothelial cell dysfunction by modulating the p38/SirT1 axis.
23855981 2013 New role of silent information regulator 1 in cerebral ischemia.
23827175 2013 Resistin impairs SIRT1 function and induces senescence-associated phenotype in hepatocytes.
23814050 2013 Methionine adenosyltransferase 2B, HuR, and sirtuin 1 protein cross-talk impacts on the effect of resveratrol on apoptosis and growth in liver cancer cells.
23800577 2013 Calorie restriction in overweight males ameliorates obesity-related metabolic alterations and cellular adaptations through anti-aging effects, possibly including AMPK and SIRT1 activation.
23797802 2013 Galloflavin suppresses lactate dehydrogenase activity and causes MYC downregulation in Burkitt lymphoma cells through NAD/NADH-dependent inhibition of sirtuin-1.
23793837 2013 Nephroprotective action of sirtuin 1 (SIRT1).
23770291 2013 Antagonistic crosstalk between NF-?B and SIRT1 in the regulation of inflammation and metabolic disorders.
23768087 2013 MiR-204 down regulates SIRT1 and reverts SIRT1-induced epithelial-mesenchymal transition, anoikis resistance and invasion in gastric cancer cells.
23760629 2013 MiR-199a-5p promotes migration and tube formation of human cytomegalovirus-infected endothelial cells through downregulation of SIRT1 and eNOS.
23754392 2013 Ca2+/calmodulin-dependent protein kinase kinase ? phosphorylation of Sirtuin 1 in endothelium is atheroprotective.
23728341 2014 MicroRNA-29c functions as a tumor suppressor by direct targeting oncogenic SIRT1 in hepatocellular carcinoma.
23725046 2014 Fasting induces nuclear factor E2-related factor 2 and ATP-binding Cassette transporters via protein kinase A and Sirtuin-1 in mouse and human.
23704280 2013 A SUMOylation-dependent pathway regulates SIRT1 transcription and lung cancer metastasis.
23702379 2013 Expression of SIRT1 and cortactin is associated with progression of non-small cell lung cancer.
23673452 2013 SIRT1 suppresses breast cancer growth through downregulation of the Bcl-2 protein.
23661372 2013 Overexpression of SIRT1 promotes high glucose-attenuated corneal epithelial wound healing via p53 regulation of the IGFBP3/IGF-1R/AKT pathway.
23636469 2014 Suppression of native defense mechanisms, SIRT1 and PPAR?, by dietary glycoxidants precedes disease in adult humans; relevance to lifestyle-engendered chronic diseases.
23613875 2013 Sirtuin1: a promising serum protein marker for early detection of Alzheimer's disease.
23583951 2013 Role of SIRT1 and FOXO factors in eNOS transcriptional activation by resveratrol.
23561972 Nicotinamide prohibits proliferation and enhances chemosensitivity of pancreatic cancer cells through deregulating SIRT1 and Ras/Akt pathways.
23548308 2013 Molecular architecture of the human protein deacetylase Sirt1 and its regulation by AROS and resveratrol.
23542177 2014 SIRT1 regulates YAP2-mediated cell proliferation and chemoresistance in hepatocellular carcinoma.
23505545 2013 SIRT1 polymorphism, long-term survival and glucose tolerance in the general population.
23483263 2013 cAMP signalling inhibits p53 acetylation and apoptosis via HDAC and SIRT deacetylases.
23477488 2013 Regulation of SIRT1 by oxidative stress-responsive miRNAs and a systematic approach to identify its role in the endothelium.
23475622 2013 Altered expression of SIRT gene family in head and neck squamous cell carcinoma.
23474493 2013 CBX8 suppresses Sirtinol-induced premature senescence in human breast cancer cells via cooperation with SIRT1.
23473037 2013 Identification of a SIRT1 mutation in a family with type 1 diabetes.
23453030 2013 SIRT1 expression is associated with good prognosis for head and neck squamous cell carcinoma patients.
23450480 2013 [Association between SIRT1 gene polymorphisms and longevity of populations from Yongfu region of Guangxi].
23449222 2013 Human SIRT1 regulates DNA binding and stability of the Mcm10 DNA replication factor via deacetylation.
23395904 2013 Ubc9 acetylation modulates distinct SUMO target modification and hypoxia response.
23394938 2013 The ways and means that fine tune Sirt1 activity.
23390957 2013 Incretin-stimulated interaction between ?-cell Kv1.5 and Kv?2 channel proteins involves acetylation/deacetylation by CBP/SirT1.
23382833 2013 Peripheral blood monocyte Sirt1 expression is reduced in patients with coronary artery disease.
23382074 2013 A high-confidence interaction map identifies SIRT1 as a mediator of acetylation of USP22 and the SAGA coactivator complex.
23370328 2013 Sirtuin-1 regulates acinar-to-ductal metaplasia and supports cancer cell viability in pancreatic cancer.
23365135 2013 CUL3 and NRF2 mutations confer an NRF2 activation phenotype in a sporadic form of papillary renal cell carcinoma.
23363613 2013 SIRT1 regulates the human alveolar epithelial A549 cell apoptosis induced by Pseudomonas aeruginosa lipopolysaccharide.
23361587 2013 Anti-aging molecule, Sirt1: a novel therapeutic target for diabetic nephropathy.
23357110 2013 Insulin induces neurite outgrowth via SIRT1 in SH-SY5Y cells.
23354305 2013 Genetic variation in SIRT1 affects susceptibility of lung squamous cell carcinomas in former uranium miners from the Colorado plateau.
23352644 2013 Deleted in breast cancer 1 (DBC1) deficiency results in apoptosis of breast cancer cells through impaired responses to UV-induced DNA damage.
23349863 2013 The SIRT1 modulators AROS and DBC1 regulate HSF1 activity and the heat shock response.
23340254 2013 SIRT1 positively regulates breast cancer associated human aromatase (CYP19A1) expression.
23332867 2013 Sirtuin 1 (SIRT1): a potential immunohistochemical marker and therapeutic target in soft tissue neoplasms with myoid differentiation.
23305113 2013 The combined effects of genetic variation in the SIRT1 gene and dietary intake of n-3 and n-6 polyunsaturated fatty acids on serum LDL-C and HDL-C levels: a population based study.
23276927 2013 Towards elucidating the role of SirT1 in osteoarthritis.
23267107 2013 Sirt1 suppresses RNA synthesis after UV irradiation in combined xeroderma pigmentosum group D/Cockayne syndrome (XP-D/CS) cells.
23262029 2013 Measles virus nucleocapsid protein, a key contributor to Paget's disease, increases IL-6 expression via down-regulation of FoxO3/Sirt1 signaling.
23257246 2013 SIRT1, a class III histone deacetylase, regulates TNF-?-induced inflammation in human chondrocytes.
23255128 2013 Analysis of 41 cancer cell lines reveals excessive allelic loss and novel mutations in the SIRT1 gene.
23248098 2013 Dietary resveratrol prevents development of high-grade prostatic intraepithelial neoplastic lesions: involvement of SIRT1/S6K axis.
23247634 2013 Vitamin D protects human endothelial cells from H?O? oxidant injury through the Mek/Erk-Sirt1 axis activation.
23247197 2013 Ku70 acetylation and modulation of c-Myc/ATF4/CHOP signaling axis by SIRT1 inhibition lead to sensitization of HepG2 cells to TRAIL through induction of DR5 and down-regulation of c-FLIP.
23238746 2013 SIRT1 suppresses PMA and ionomycin-induced ICAM-1 expression in endothelial cells.
23229445 2013 Effects of Sirt1 on DNA methylation and expression of genes affected by dietary restriction.
23224434 2013 The tumor suppressor protein menin inhibits NF-?B-mediated transactivation through recruitment of Sirt1 in hepatocellular carcinoma.
23224247 2013 Vascular smooth muscle cell sirtuin 1 protects against DNA damage and inhibits atherosclerosis.
23209300 2013 Role of sirtuin 1 in the regulation of hepatic gene expression by thyroid hormone.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23178529 2013 Omentin-1, a new adipokine, promotes apoptosis through regulating Sirt1-dependent p53 deacetylation in hepatocellular carcinoma cells.
23169992 2013 SIRT1 represses estrogen-signaling, ligand-independent ER?-mediated transcription, and cell proliferation in estrogen-responsive breast cells.
23143889 2013 The overexpression of SIRT1 inhibited osteoarthritic gene expression changes induced by interleukin-1? in human chondrocytes.
23137540 2012 SIRT1 sensitizes hepatocellular carcinoma cells expressing hepatitis B virus X protein to oxidative stress-induced apoptosis.
23135526 2013 Expression of SIRT1 in choroidal neovascular membranes.
23133645 2012 The interactive effect of SIRT1 promoter region polymorphism on type 2 diabetes susceptibility in the North Indian population.
23079621 2012 SIRT1 deacetylates RFX5 and antagonizes repression of collagen type I (COL1A2) transcription in smooth muscle cells.
23075766 2012 SIRT1 regulates CD40 expression induced by TNF-? via NF-?B pathway in endothelial cells.
23075334 2013 Sirtuins and renal diseases: relationship with aging and diabetic nephropathy.
23070058 2013 Poor glycaemic control in type 2 diabetes patients reduces endothelial progenitor cell number by influencing SIRT1 signalling via platelet-activating factor receptor activation.
23056314 2012 Angiogenesis inhibitor vasohibin-1 enhances stress resistance of endothelial cells via induction of SOD2 and SIRT1.
23050959 2012 Janus-faced role of SIRT1 in tumorigenesis.
23045412 2012 Up-regulation of c-MYC and SIRT1 expression correlates with malignant transformation in the serrated route to colorectal cancer.
23038275 2013 SIRT1 enhances matrix metalloproteinase-2 expression and tumor cell invasion in prostate cancer cells.
23024800 2012 SIRT1 and c-Myc promote liver tumor cell survival and predict poor survival of human hepatocellular carcinomas.
22995302 2012 SIRT1 inactivation induces inflammation through the dysregulation of autophagy in human THP-1 cells.
22990594 2013 SIRT1 inhibits apoptosis of degenerative human disc nucleus pulposus cells through activation of Akt pathway.
22986747 2012 SIRT1 pathway dysregulation in the smoke-exposed airway epithelium and lung tumor tissue.
22986535 2013 SIRT1 promotes thyroid carcinogenesis driven by PTEN deficiency.
22980663 2012 [Expression of SIRT1 in right auricle tissues and the relationship with oxidative stress in patients with atrial fibrillation].
22956909 2012 Dynamic distribution of linker histone H1.5 in cellular differentiation.
22935421 2012 Genetic analysis of the SIRT1 gene promoter in myocardial infarction.
22934845 2013 SIRT1 as a novel potential treatment target for vascular aging and age-related vascular diseases.
22902550 2013 miR-34a/SIRT1/p53 is suppressed by ursodeoxycholic acid in the rat liver and activated by disease severity in human non-alcoholic fatty liver disease.
22893703 2012 Sirtuin 1 is a key regulator of the interleukin-12 p70/interleukin-23 balance in human dendritic cells.
22885181 2012 Genetic analysis of the SIRT1 gene promoter in ventricular septal defects.
22867969 2012 SIRT1 promotes proliferation and inhibits apoptosis of human malignant glioma cell lines.
22863012 2012 Brown remodeling of white adipose tissue by SirT1-dependent deacetylation of Ppar?.
22836009 2012 SORL1 and SIRT1 mRNA expression and promoter methylation levels in aging and Alzheimer's Disease.
22833338 2013 Resveratrol-mediated apoptosis of hodgkin lymphoma cells involves SIRT1 inhibition and FOXO3a hyperacetylation.
22824213 2012 Association study of sirtuin 1 polymorphisms with bone mineral density and body mass index.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22807441 2012 The acetylase/deacetylase couple CREB-binding protein/Sirtuin 1 controls hypoxia-inducible factor 2 signaling.
22796962 2013 Differential sirtuin expression patterns in amyotrophic lateral sclerosis (ALS) postmortem tissue: neuroprotective or neurotoxic properties of sirtuins in ALS?
22789853 2012 SIRT1 interacts with and protects glyceraldehyde-3-phosphate dehydrogenase (GAPDH) from nuclear translocation: implications for cell survival after irradiation.
22780949 2012 Regulation of SIRT1 determines initial step of endometrial receptivity by controlling E-cadherin expression.
22773876 2012 GATA-binding protein 4 (GATA-4) and T-cell acute leukemia 1 (TAL1) regulate myogenic differentiation and erythropoietin response via cross-talk with Sirtuin1 (Sirt1).
22740055 2012 Association of SIRT1 expression with shear stress induced endothelial progenitor cell differentiation.
22735644 2012 DBC1 phosphorylation by ATM/ATR inhibits SIRT1 deacetylase in response to DNA damage.
22732402 2012 Inhibition of SIRT1 by HIV-1 viral protein Tat results in activation of p53 pathway.
22728651 2012 AMPK promotes p53 acetylation via phosphorylation and inactivation of SIRT1 in liver cancer cells.
22703651 2012 The role of SIRT1 on angiogenic and odontogenic potential in human dental pulp cells.
22700961 2012 NAD+-dependent sirtuin 1 and 6 proteins coordinate a switch from glucose to fatty acid oxidation during the acute inflammatory response.
22696478 2012 Sirt1, p53, and p38(MAPK) are crucial regulators of detrimental phenotypes of embryonic stem cells with Max expression ablation.
22689577 2012 Sirt-1 is required for the inhibition of apoptosis and inflammatory responses in human tenocytes.
22683888 2012 TNF-? inhibits PPAR?/? activity and SIRT1 expression through NF-?B in human adipocytes.
22683003 2012 Porphyromonas gingivalis lipopolysaccharide regulates interleukin (IL)-17 and IL-23 expression via SIRT1 modulation in human periodontal ligament cells.
22674476 2012 Effect of dietary macronutrient composition on AMPK and SIRT1 expression and activity in human skeletal muscle.
22661383 2012 Expression of SIRT1 is associated with lymph node metastasis and poor prognosis in both operable triple-negative and non-triple-negative breast cancer.
22640743 2012 SIRT1 inhibits proliferation of pancreatic cancer cells expressing pancreatic adenocarcinoma up-regulated factor (PAUF), a novel oncogene, by suppression of ?-catenin.
22628222 2013 Hepatoprotection of berberine against hydrogen peroxide-induced apoptosis by upregulation of Sirtuin 1.
22623155 2013 MiR-34a inhibits proliferation and migration of breast cancer through down-regulation of Bcl-2 and SIRT1.
22613205 2012 Genetic analysis of SIRT1 gene promoter in sporadic Parkinson's disease.
22590959 2012 [Sirt1-mediated autophagy in aging kidney].
22586264 2012 SIRT1 negatively regulates the activities, functions, and protein levels of hMOF and TIP60.
22584570 2012 Neurodegeneration-associated TDP-43 interacts with fragile X mental retardation protein (FMRP)/Staufen (STAU1) and regulates SIRT1 expression in neuronal cells.
22564731 2012 SIRT1 attenuates palmitate-induced endoplasmic reticulum stress and insulin resistance in HepG2 cells via induction of oxygen-regulated protein 150.
22554968 2012 Loss of SIRT1 histone deacetylase expression associates with tumour progression in colorectal adenocarcinoma.
22553202 2012 Role of deleted in breast cancer 1 (DBC1) protein in SIRT1 deacetylase activation induced by protein kinase A and AMP-activated protein kinase.
22552445 2012 SIRT1 promotes tumorigenesis of hepatocellular carcinoma through PI3K/PTEN/AKT signaling.
22537175 2013 Expression patterns and potential roles of SIRT1 in human medulloblastoma cells in vivo and in vitro.
22510882 2012 Novel repressor regulates insulin sensitivity through interaction with Foxo1.
22510409 2012 Molecular dissection of the interaction between HIC1 and SIRT1.
22493485 2012 Nicotinamide-induced mitophagy: event mediated by high NAD+/NADH ratio and SIRT1 protein activation.
22479397 2012 Inhibition of SIRT1 impairs the accumulation and transcriptional activity of HIF-1? protein under hypoxic conditions.
22465953 2012 Regulation of SIRT1 activity by genotoxic stress.
22448750 2012 SirT1 regulates radiosensitivity of hepatoma cells differently under normoxic and hypoxic conditions.
22410779 2013 SIRT1 deacetylase promotes acquisition of genetic mutations for drug resistance in CML cells.
22406815 2012 MiR-217 is involved in Tat-induced HIV-1 long terminal repeat (LTR) transactivation by down-regulation of SIRT1.
22385246 2012 Mechanical stress-activated immune response genes via Sirtuin 1 expression in human periodontal ligament cells.
22378745 2012 A novel inverse relationship between metformin-triggered AMPK-SIRT1 signaling and p53 protein abundance in high glucose-exposed HepG2 cells.
22370592 2013 Anti-correlation between longevity gene SirT1 and Notch signaling in ascending aorta biopsies from patients with bicuspid aortic valve disease.
22364258 2012 MicroRNA-34a regulates the longevity-associated protein SIRT1 in coronary artery disease: effect of statins on SIRT1 and microRNA-34a expression.
22363646 2012 Activating transcription factor 4 confers a multidrug resistance phenotype to gastric cancer cells through transactivation of SIRT1 expression.
22355666 2011 SIRT1 associates with eIF2-alpha and regulates the cellular stress response.
22340598 2012 Activation of p53 by SIRT1 inhibition enhances elimination of CML leukemia stem cells in combination with imatinib.
22333659 2012 Expression of SIRT1 in ocular surface squamous neoplasia.
22330808 2012 SIRT1 overexpression decreases cisplatin-induced acetylation of NF-?B p65 subunit and cytotoxicity in renal proximal tubule cells.
22322739 2012 High expression of the longevity gene product SIRT1 and apoptosis induction by sirtinol in adult T-cell leukemia cells.
22312127 2012 Three novel acetylation sites in the Foxp3 transcription factor regulate the suppressive activity of regulatory T cells.
22308024 2012 MicroRNA-217 promotes ethanol-induced fat accumulation in hepatocytes by down-regulating SIRT1.
22306819 2012 NAD-dependent histone deacetylase, SIRT1, plays essential roles in the maintenance of hematopoietic stem cells.
22302044 2012 SirT1 confers hypoxia-induced radioresistance via the modulation of c-Myc stabilization on hepatoma cells.
22274616 2012 PML regulates PER2 nuclear localization and circadian function.
22272724 2012 Sirtuin1 in tracheal aspirate leukocytes: possible role in the development of bronchopulmonary dysplasia in premature infants.
22266962 2012 Hypoxanthine-xanthine oxidase down-regulates GLUT1 transcription via SIRT1 resulting in decreased glucose uptake in human placenta.
22249256 2012 SIRT1 induces EMT by cooperating with EMT transcription factors and enhances prostate cancer cell migration and metastasis.
22245592 2012 Involvement of SIRT1 in hypoxic down-regulation of c-Myc and ?-catenin and hypoxic preconditioning effect of polyphenols.
22230810 2012 Three single nucleotide variants of the SIRT1 gene are associated with overweight in a Chinese population: a case control study.
22228742 2012 Variants in the SIRT1 gene may affect diabetes risk in interaction with prenatal exposure to famine.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22219708 2010 SirT1--a sensor for monitoring self-renewal and aging process in retinal stem cells.
22207735 2012 Activation of stress response gene SIRT1 by BCR-ABL promotes leukemogenesis.
22200427 2012 SIRTUIN 1 gene polymorphisms are associated with cholesterol metabolism and coronary artery calcification in Japanese hemodialysis patients.
22198152 2012 Nicotinamide, a SIRT1 inhibitor, inhibits differentiation and facilitates expansion of hematopoietic progenitor cells with enhanced bone marrow homing and engraftment.
22197555 2012 SIRT1 prevents replicative senescence of normal human umbilical cord fibroblast through potentiating the transcription of human telomerase reverse transcriptase gene.
22190494 2012 The c-MYC oncoprotein, the NAMPT enzyme, the SIRT1-inhibitor DBC1, and the SIRT1 deacetylase form a positive feedback loop.
22190034 2011 Global landscape of HIV-human protein complexes.
22178470 2012 SIRT1 as a therapeutic target in inflammaging of the pulmonary disease.
22169038 2011 SIRT1 activates MAO-A in the brain to mediate anxiety and exploratory drive.
22159506 2012 Sirtuin 1 (SIRT1) and steroid hormone receptor activity in cancer.
22157016 2012 SIRT1 contains N- and C-terminal regions that potentiate deacetylase activity.
22157007 2012 Regulation of glycolytic enzyme phosphoglycerate mutase-1 by Sirt1 protein-mediated deacetylation.
22152608 2011 Expression of silent mating type information regulator 2 homolog 1 and its role in human intervertebral disc cell homeostasis.
22149272 2012 SIRT1 and the clock gene machinery in colorectal cancer.
22146883 2012 SIRT1 promotes tumorigenesis and resistance to chemotherapy in hepatocellular carcinoma and its expression predicts poor prognosis.
22137654 2012 Region-specific changes in the immunoreactivity of SIRT1 expression in the central nervous system of SOD1(G93A) transgenic mice as an in vivo model of amyotrophic lateral sclerosis.
22133824 2011 [Bone and calcium update; diagnosis and therapy of bone metabolism disease update. Regulatory Mechanism of Mammalian Sirtuin SIRT1 in Vascular calcification: impact of vascular smooth muscle cell senescence].
22124156 2012 A deacetylase-deficient SIRT1 variant opposes full-length SIRT1 in regulating tumor suppressor p53 and governs expression of cancer-related genes.
22121772 2011 [Effects of baicalin against oxidative stress injury of SH-SY5Y cells by up-regulating SIRT1].
22094255 2011 Oxidative damage targets complexes containing DNA methyltransferases, SIRT1, and polycomb members to promoter CpG Islands.
22073865 2011 [Sirt1 in diabetic nephropathy].
22050448 2012 Inhibition of cortactin and SIRT1 expression attenuates migration and invasion of prostate cancer DU145 cells.
22038097 2012 SIRT1 is required for long-term growth of human mesenchymal stem cells.
22017869 2011 Peptide switch is essential for Sirt1 deacetylase activity.
22000456 2011 Role of SIRT1 in heat stress- and lipopolysaccharide-induced immune and defense gene expression in human dental pulp cells.
21987377 2012 75-kd sirtuin 1 blocks tumor necrosis factor ?-mediated apoptosis in human osteoarthritic chondrocytes.
21972126 2012 Telomere maintenance genes SIRT1 and XRCC6 impact age-related decline in telomere length but only SIRT1 is associated with human longevity.
21968188 2011 p53 deacetylation by SIRT1 decreases during protein kinase CKII downregulation-mediated cellular senescence.
21947282 2011 SIRT1 deacetylates the DNA methyltransferase 1 (DNMT1) protein and alters its activities.
21933665 2011 Energy sensing factors PGC-1? and SIRT1 modulate PXR expression and function.
21920899 2011 SIRT1 is essential for oncogenic signaling by estrogen/estrogen receptor ? in breast cancer.
21915620 2012 The time-dependent autophagy protects against apoptosis with possible involvement of Sirt1 protein in multiple myeloma under nutrient depletion.
21909281 2011 The evolutionarily conserved longevity determinants HCF-1 and SIR-2.1/SIRT1 collaborate to regulate DAF-16/FOXO.
21890893 2011 SIRT1 links CIITA deacetylation to MHC II activation.
21882241 2011 No significant association between SIRT1 gene and methamphetamine-induced psychosis in the Japanese population.
21871827 2011 SIRT1 is associated with a decrease in acute insulin secretion and a sex specific increase in risk for type 2 diabetes in Pima Indians.
21865267 2011 Expression of SIRT1 in gastric cardiac cancer and its clinicopathologic significance.
21852339 2012 Dietary factors and lung function in the general population: wine and resveratrol intake.
21841822 2012 Deacetylation of FOXO3 by SIRT1 or SIRT2 leads to Skp2-mediated FOXO3 ubiquitination and degradation.
21832856 2011 Why do our kidneys get old?
21813271 2012 Resveratrol up-regulates SIRT1 and inhibits cellular oxidative stress in the diabetic milieu: mechanistic insights.
21810449 2011 Roles of SIRT1 in high glucose-induced endothelial impairment: association with diabetic atherosclerosis.
21807113 2011 Sirt1 deacetylates c-Myc and promotes c-Myc/Max association.
21789216 2011 CBP/p300 and SIRT1 are involved in transcriptional regulation of S-phase specific histone genes.
21778425 2011 Repression of P66Shc expression by SIRT1 contributes to the prevention of hyperglycemia-induced endothelial dysfunction.
21775285 2011 The deacetylase SIRT1 promotes membrane localization and activation of Akt and PDK1 during tumorigenesis and cardiac hypertrophy.
21760635 2012 Association of sirtuin 1 (SIRT1) gene SNPs and transcript expression levels with severe obesity.
21746786 2011 SIRT-1 and vascular endothelial dysfunction with ageing in mice and humans.
21745208 2011 The role of sirtuin 1 in osteoblastic differentiation in human periodontal ligament cells.
21720722 2012 Target gene repression mediated by miRNAs miR-181c and miR-9 both of which are down-regulated by amyloid-?.
21719763 2011 Sirtuin 1 retards hyperphosphatemia-induced calcification of vascular smooth muscle cells.
21703114 2011 Inhibition of SIRT1 increases EZH2 protein level and enhances the repression of EZH2 on target gene expression.
21701047 2011 SIRT1 and SIRT3 deacetylate homologous substrates: AceCS1,2 and HMGCS1,2.
21700104 2011 Severity of lens opacity, age, and correlation of the level of silent information regulator T1 expression in age-related cataract.
21698133 2011 SIRT1 promotes N-Myc oncogenesis through a positive feedback loop involving the effects of MKP3 and ERK on N-Myc protein stability.
21697093 2011 Nicotinamide phosphoribosyltransferase is essential for interleukin-1beta-mediated dedifferentiation of articular chondrocytes via SIRT1 and extracellular signal-regulated kinase (ERK) complex signaling.
21636977 2011 Human SIRT1 associates with mitotic chromatin and contributes to chromosomal condensation.
21604001 2011 Effects of 2-deoxyglucose and dehydroepiandrosterone on intracellular NAD(+) level, SIRT1 activity and replicative lifespan of human Hs68 cells.
21596753 2011 miR-200a regulates SIRT1 expression and epithelial to mesenchymal transition (EMT)-like transformation in mammary epithelial cells.
21567102 2011 Expression and role of SIRT1 in hepatocellular carcinoma.
21556116 2011 The expression of Sirtuins 1 and 4 in peripheral blood leukocytes from patients with type 2 diabetes.
21555002 EVI1 up-regulates the stress responsive gene SIRT1 which triggers deacetylation and degradation of EVI1.
21543634 2011 Nuclear SIRT1 activity, but not protein content, regulates mitochondrial biogenesis in rat and human skeletal muscle.
21533107 2011 Rapid temporal control of Foxp3 protein degradation by sirtuin-1.
21527554 2011 Sirtuin 1 is upregulated in a subset of hepatocellular carcinomas where it is essential for telomere maintenance and tumor cell growth.
21505241 2011 Cloning, purification, crystallization and preliminary crystallographic analysis of the human histone deacetylase sirtuin 1.
21504832 2011 Stabilization of Suv39H1 by SirT1 is part of oxidative stress response and ensures genome protection.
21502975 2011 Modulations of hMOF autoacetylation by SIRT1 regulate hMOF recruitment and activities on the chromatin.
21502801 2012 The effects of caloric restriction and a high-fat diet on ovarian lifespan and the expression of SIRT1 and SIRT6 proteins in rats.
21501079 2011 Changes in SIRT1 expression and its downstream pathways in age-related cataract in humans.
21474819 2011 SIRT1 acts as a modulator of neointima formation following vascular injury in mice.
21471201 2011 Cancer cell survival following DNA damage-mediated premature senescence is regulated by mammalian target of rapamycin (mTOR)-dependent Inhibition of sirtuin 1.
21454709 2011 The type III histone deacetylase Sirt1 protein suppresses p300-mediated histone H3 lysine 56 acetylation at Bclaf1 promoter to inhibit T cell activation.
21414717 2011 Sirtuin 1 in malignant transformation: friend or foe?
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21390332 2011 p16(INK4a) suppression by glucose restriction contributes to human cellular lifespan extension through SIRT1-mediated epigenetic and genetic mechanisms.
21349544 2011 Altered sirtuin deacetylase gene expression in patients with a mood disorder.
21345792 2011 Hypoxia increases sirtuin 1 expression in a hypoxia-inducible factor-dependent manner.
21337390 2011 Potential involvement of SIRT1 in the pathogenesis of osteoarthritis through the modulation of chondrocyte gene expressions.
21331741 2011 Association between single nucleotide polymorphisms within genes encoding sirtuin families and diabetic nephropathy in Japanese subjects with type 2 diabetes.
21329659 2011 Acetylation of pregnane X receptor protein determines selective function independent of ligand activation.
21305533 2011 Tumor necrosis factor ?-mediated cleavage and inactivation of SirT1 in human osteoarthritic chondrocytes.
21289058 2011 Transcription factor FOXL2 protects granulosa cells from stress and delays cell cycle: role of its regulation by the SIRT1 deacetylase.
21277951 2011 Silent information regulator 1 mediates hippocampal plasticity through presenilin1.
21269460 2011 Initial characterization of the human central proteome.
21245319 2011 Methyltransferase Set7/9 regulates p53 activity by interacting with Sirtuin 1 (SIRT1).