Property Summary

NCBI Gene PubMed Count 759
Grant Count 977
R01 Count 564
Funding $117,432,470.61
PubMed Score 2958.59
PubTator Score 1855.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
adrenocortical carcinoma -1.894 0.000
ovarian cancer -1.200 0.002

Synonym

Accession Q96EB6 Q2XNF6 Q5JVQ0 Q9GZR9 Q9Y6F0 hSIRT1
Symbols SIR2
SIR2L1
SIR2alpha

Gene

PDB

4ZZJ   4I5I   4IF6   4IG9   4KXQ   4ZZH   4ZZI   5BTR  

Gene RIF (758)

PMID Text
27333745 It is a protein deacetylase that has been reported to suppress cardiovascular pathologies such as myocardial infarction, and neurodegenerative diseases. (review)
27089876 several common single nucleotide polymorphisms(rs12778366, rs3758391, rs3740051, rs33957861, rs7896005, rs12413112, rs11599176 and rs4746720) in the SIRT1 gene are not associated with human longevity
26999517 rs3758391 and rs12778366 polymorphisms of SIRT1 gene are associated with breast cancer risk and prognosis in the Egyptian population.
26987484 myeloid cell-specific deletion of SIRT1 appeared to suppress CIA by modulating DC maturation.
26975631 SIRT1 expression correlated positively with Fra-1 expression, metastasis and overall survival in patients with colorectal cancer
26896648 Studies indicate that when NAD+ levels drop, SIRT1 protein activity is reduced, leading to mitochondrial dysfunction.
26890260 SIRT1 is an important regulator of lipid and carbohydrate metabolisms within human fetal hepatocytes, acting as an adaptive transcriptional response to environmental changes.
26831453 Although primarily a nuclear protein, Sirt1 deacetylation of PGC-1a has been extensively implicated in metabolic control and mitochondrial biogenesis, which was proposed to partially underlie Sirt1 role in caloric restriction and impacts on longevity. (Review)
26768367 Therefore, our results support a link between PD and SIRT1/HIF-1alpha signaling, which may serve as a clue for understanding PD.
26752489 SIRT1 exerted anti-inflammatory effects in degenerative nucleus pulposus cells through TLR2/SIRT1/NF-kappaB pathway.
More...

AA Sequence

MADEAALALQPGGSPSAAGADREAASSPAGEPLRKRPRRDGPGLERSPGEPGGAAPEREVPAAARGCPGA      1 - 70
AAAALWREAEAEAAAAGGEQEAQATAAAGEGDNGPGLQGPSREPPLADNLYDEDDDDEGEEEEEAAAAAI     71 - 140
GYRDNLLFGDEIITNGFHSCESDEEDRASHASSSDWTPRPRIGPYTFVQQHLMIGTDPRTILKDLLPETI    141 - 210
PPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIY    211 - 280
ARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTL    281 - 350
EQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPE    351 - 420
QFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELC    421 - 490
HRLGGEYAKLCCNPVKLSEITEKPPRTQKELAYLSELPPTPLHVSEDSSSPERTSPPDSSVIVTLLDQAA    491 - 560
KSNDDLDVSESKGCMEEKPQEVQTSRNVESIAEQMENPDLKNVGSSTGEKNERTSVAGTVRKCWPNRVAK    561 - 630
EQISRRLDGNQYLFLPPNRYIFHGAEVYSDSEDDVLSSSSCGSNSDSGTCQSPSLEEPMEDESEIEEFYN    631 - 700
GLEDEPDVPERAGGAGFGTDGDDQEAINEAISVKQEVTDMNYPSNKS                           701 - 747
//

Text Mined References (782)

PMID Year Title
27333745 2016 [SIRT1].
27089876 2016 Common variants in SIRT1 and human longevity in a Chinese population.
26999517 2016 Association between SIRT1 Gene Polymorphisms and Breast Cancer in Egyptians.
26987484 2016 Myeloid deletion of SIRT1 suppresses collagen-induced arthritis in mice by modulating dendritic cell maturation.
26975631 2016 SIRT1 promotes epithelial-mesenchymal transition and metastasis in colorectal cancer by regulating Fra-1 expression.
26896648 2016 Chronic alcohol binging injures the liver and other organs by reducing NAD? levels required for sirtuin's deacetylase activity.
26890260 2016 SIRT1 Disruption in Human Fetal Hepatocytes Leads to Increased Accumulation of Glucose and Lipids.
26831453 2016 Sirt1 and the Mitochondria.
26768367 2016 The epigenetic regulation of HIF-1? by SIRT1 in MPP(+) treated SH-SY5Y cells.
26752489 2016 SIRT1 Inhibits the Catabolic Effect of IL-1? Through TLR2/SIRT1/NF-?B Pathway in Human Degenerative Nucleus Pulposus Cells.
More...