Property Summary

Ligand Count 70
NCBI Gene PubMed Count 911
PubMed Score 3413.68
PubTator Score 1855.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
African trypanosomiasis 5
Disease Target Count P-value
adrenocortical carcinoma 1428 8.4e-10
ovarian cancer 8520 1.8e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (2)

Disease log2 FC p
adrenocortical carcinoma -1.894 8.4e-10
ovarian cancer -1.200 1.8e-03

Protein-protein Interaction (2)

Gene RIF (887)

AA Sequence

MADEAALALQPGGSPSAAGADREAASSPAGEPLRKRPRRDGPGLERSPGEPGGAAPEREVPAAARGCPGA      1 - 70
AAAALWREAEAEAAAAGGEQEAQATAAAGEGDNGPGLQGPSREPPLADNLYDEDDDDEGEEEEEAAAAAI     71 - 140
GYRDNLLFGDEIITNGFHSCESDEEDRASHASSSDWTPRPRIGPYTFVQQHLMIGTDPRTILKDLLPETI    141 - 210
PPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIY    211 - 280
ARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTL    281 - 350
EQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPE    351 - 420
QFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELC    421 - 490
HRLGGEYAKLCCNPVKLSEITEKPPRTQKELAYLSELPPTPLHVSEDSSSPERTSPPDSSVIVTLLDQAA    491 - 560
KSNDDLDVSESKGCMEEKPQEVQTSRNVESIAEQMENPDLKNVGSSTGEKNERTSVAGTVRKCWPNRVAK    561 - 630
EQISRRLDGNQYLFLPPNRYIFHGAEVYSDSEDDVLSSSSCGSNSDSGTCQSPSLEEPMEDESEIEEFYN    631 - 700
GLEDEPDVPERAGGAGFGTDGDDQEAINEAISVKQEVTDMNYPSNKS                           701 - 747
//

Text Mined References (934)

PMID Year Title