Property Summary

NCBI Gene PubMed Count 22
PubMed Score 17.65
PubTator Score 29.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
ovarian cancer 1.400 4.0e-04
psoriasis 1.300 1.2e-03
tuberculosis 1.300 5.1e-06

Gene RIF (4)

AA Sequence

MAAVATCGSVAASTGSAVATASKSNVTSFQRRGPRASVTNDSGPRLVSIAGTRPSVRNGQLLVSTGLPAL      1 - 70
DQLLGGGLAVGTVLLIEEDKYNIYSPLLFKYFLAEGIVNGHTLLVASAKEDPANILQELPAPLLDDKCKK     71 - 140
EFDEDVYNHKTPESNIKMKIAWRYQLLPKMEIGPVSSSRFGHYYDASKRMPQELIEASNWHGFFLPEKIS    141 - 210
STLKVEPCSLTPGYTKLLQFIQNIIYEEGFDGSNPQKKQRNILRIGIQNLGSPLWGDDICCAENGGNSHS    211 - 280
LTKFLYVLRGLLRTSLSACIITMPTHLIQNKAIIARVTTLSDVVVGLESFIGSERETNPLYKDYHGLIHI    281 - 350
RQIPRLNNLICDESDVKDLAFKLKRKLFTIERLHLPPDLSDTVSRSSKMDLAESAKRLGPGCGMMAGGKK    351 - 420
HLDF                                                                      421 - 424
//

Text Mined References (27)

PMID Year Title