Property Summary

NCBI Gene PubMed Count 22
PubMed Score 17.65
PubTator Score 29.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
ovarian cancer 1.400 4.0e-04
psoriasis 1.300 1.2e-03
tuberculosis 1.300 5.1e-06

Synonym

Accession Q96EB1 B4E3W0 E7EPZ6 Q9H4E8 Q9NX11 hELP4
Symbols AN
AN2
hELP4
PAXNEB
PAX6NEB
C11orf19
dJ68P15A.1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (4)

AA Sequence

MAAVATCGSVAASTGSAVATASKSNVTSFQRRGPRASVTNDSGPRLVSIAGTRPSVRNGQLLVSTGLPAL      1 - 70
DQLLGGGLAVGTVLLIEEDKYNIYSPLLFKYFLAEGIVNGHTLLVASAKEDPANILQELPAPLLDDKCKK     71 - 140
EFDEDVYNHKTPESNIKMKIAWRYQLLPKMEIGPVSSSRFGHYYDASKRMPQELIEASNWHGFFLPEKIS    141 - 210
STLKVEPCSLTPGYTKLLQFIQNIIYEEGFDGSNPQKKQRNILRIGIQNLGSPLWGDDICCAENGGNSHS    211 - 280
LTKFLYVLRGLLRTSLSACIITMPTHLIQNKAIIARVTTLSDVVVGLESFIGSERETNPLYKDYHGLIHI    281 - 350
RQIPRLNNLICDESDVKDLAFKLKRKLFTIERLHLPPDLSDTVSRSSKMDLAESAKRLGPGCGMMAGGKK    351 - 420
HLDF                                                                      421 - 424
//

Text Mined References (27)

PMID Year Title