Property Summary

NCBI Gene PubMed Count 11
Grant Count 2
Funding $80,682.6
PubMed Score 21.20
PubTator Score 8.34

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96EA4 B4E393 C9JS47 Q8TEC8 Q9HD44 Q9NX97 hSpindly
Symbols CCDC99

Gene

 Grant Application (2)

Gene RIF (5)

PMID Text
25825516 hSpindly is farnesylated in vivo and farnesylation is essential for its interaction with the RZZ complex and hence Kinetochore localization.
25808490 Farnesylation of Spindly is essential for its localization, & thus for proper localization of dynein & dynactin, to prometaphase kinetochores. Both Spindly and CENP-E farnesylation are required for efficient chromosome congression
20439434 dynein-mediated removal of Spindly from microtubule-attached kinetochores, rather than poleward transport per se, is the critical reaction in checkpoint silencing
20427577 Spindly is not only required for kinetochore localization of dynein but is a functional component of a mechanism that couples dynein-dependent poleward movement of chromosomes to their efficient attachment to microtubules.
19468067 [hSpindly] Localization of human Spindly (hSpindly) to kinetochores is controlled by the Rod/Zw10/Zwilch (RZZ) complex and Aurora B.

AA Sequence

MEADIITNLRCRLKEAEEERLKAAQYGLQLVESQNELQNQLDKCRNEMMTMTESYEQEKYTLQREVELKS      1 - 70
RMLESLSCECEAIKQQQKMHLEKLEEQLSRSHGQEVNELKTKIEKLKVELDEARLSEKQLKHQVDHQKEL     71 - 140
LSCKSEELRVMSERVQESMSSEMLALQIELTEMESMKTTLKEEVNELQYRQEQLELLITNLMRQVDRLKE    141 - 210
EKEEREKEAVSYYNALEKARVANQDLQVQLDQALQQALDPNSKGNSLFAEVEDRRAAMERQLISMKVKYQ    211 - 280
SLKKQNVFNREQMQRMKLQIATLLQMKGSQTEFEQQERLLAMLEQKNGEIKHLLGEIRNLEKFKNLYDSM    281 - 350
ESKPSVDSGTLEDNTYYTDLLQMKLDNLNKEIESTKGELSIQRMKALFESQRALDIERKLFANERCLQLS    351 - 420
ESENMKLRAKLDELKLKYEPEETVEVPVLKKRREVLPVDITTAKDACVNNSALGGEVYRLPPQKEETQSC    421 - 490
PNSLEDNNLQLEKSVSIYTPVVSLSPHKNLPVDMQLKKEKKCVKLIGVPADAEALSERSGNTPNSPRLAA    491 - 560
ESKLQTEVKEGKETSSKLEKETCKKLHPILYVSSKSTPETQCPQQ                             561 - 605
//

Text Mined References (20)

PMID Year Title
25825516 2015 A novel role of farnesylation in targeting a mitotic checkpoint protein, human Spindly, to kinetochores.
25808490 2015 Preventing farnesylation of the dynein adaptor Spindly contributes to the mitotic defects caused by farnesyltransferase inhibitors.
25416956 2014 A proteome-scale map of the human interactome network.
23382074 2013 A high-confidence interaction map identifies SIRT1 as a mediator of acetylation of USP22 and the SAGA coactivator complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20439434 2010 Removal of Spindly from microtubule-attached kinetochores controls spindle checkpoint silencing in human cells.
20427577 2010 Spindly/CCDC99 is required for efficient chromosome congression and mitotic checkpoint regulation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...