Property Summary

NCBI Gene PubMed Count 13
PubMed Score 31.35
PubTator Score 8.34

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

AA Sequence

MEADIITNLRCRLKEAEEERLKAAQYGLQLVESQNELQNQLDKCRNEMMTMTESYEQEKYTLQREVELKS      1 - 70
RMLESLSCECEAIKQQQKMHLEKLEEQLSRSHGQEVNELKTKIEKLKVELDEARLSEKQLKHQVDHQKEL     71 - 140
LSCKSEELRVMSERVQESMSSEMLALQIELTEMESMKTTLKEEVNELQYRQEQLELLITNLMRQVDRLKE    141 - 210
EKEEREKEAVSYYNALEKARVANQDLQVQLDQALQQALDPNSKGNSLFAEVEDRRAAMERQLISMKVKYQ    211 - 280
SLKKQNVFNREQMQRMKLQIATLLQMKGSQTEFEQQERLLAMLEQKNGEIKHLLGEIRNLEKFKNLYDSM    281 - 350
ESKPSVDSGTLEDNTYYTDLLQMKLDNLNKEIESTKGELSIQRMKALFESQRALDIERKLFANERCLQLS    351 - 420
ESENMKLRAKLDELKLKYEPEETVEVPVLKKRREVLPVDITTAKDACVNNSALGGEVYRLPPQKEETQSC    421 - 490
PNSLEDNNLQLEKSVSIYTPVVSLSPHKNLPVDMQLKKEKKCVKLIGVPADAEALSERSGNTPNSPRLAA    491 - 560
ESKLQTEVKEGKETSSKLEKETCKKLHPILYVSSKSTPETQCPQQ                             561 - 605
//

Text Mined References (23)

PMID Year Title