Property Summary

NCBI Gene PubMed Count 33
PubMed Score 118.97
PubTator Score 55.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
tuberculosis 2010 2.1e-04
interstitial cystitis 2312 3.1e-03
Common variable immunodeficiency 101 2.4e-02
Disease Target Count Z-score Confidence
Listeriosis 18 3.328 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
tuberculosis 1.400 2.1e-04
Common variable immunodeficiency 1.092 2.4e-02
interstitial cystitis 1.400 3.1e-03

 MGI Phenotype (1)

 CSPA Cell Line (2)

Protein-protein Interaction (1)

Gene RIF (24)

AA Sequence

MTDSVIYSMLELPTATQAQNDYGPQQKSSSSRPSCSCLVAIALGLLTAVLLSVLLYQWILCQGSNYSTCA      1 - 70
SCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSEAFCWIGLRNNSG     71 - 140
WRWEDGSPLNFSRISSNSFVQTCGAINKNGLQASSCEVPLHWVCKKCPFADQALF                   141 - 195
//

Text Mined References (35)

PMID Year Title