Property Summary

NCBI Gene PubMed Count 30
Grant Count 78
R01 Count 53
Funding $8,372,093.67
PubMed Score 112.13
PubTator Score 55.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
tuberculosis 1.400 0.000
Common variable immunodeficiency 1.092 0.024
interstitial cystitis 1.400 0.003

Synonym

Accession Q96E93 B7ZAM2 O43198 O75613
Symbols 2F1
MAFA
MAFA-L
CLEC15A
MAFA-2F1
MAFA-LIKE

Gene

PDB

3FF7  

Gene RIF (21)

PMID Text
26014037 This finding provides a rationale for the reciprocal expression of KLRG1 and CD103 in different CD8(+) T-cell subsets.
24752778 high levels of TfRs such as those found on activated lymphocytes were found to be associated with decreased KLRG1 inhibitory function, indicating that TfRs may sequester KLRG1 from interacting with cadherins.
24337749 KLRG1 was overexpressed on CD4(+) T cells.
24022692 Data indicate that increments of CD8 + effector memory T cells in human and mouse chronic lymphocytic leukemia (CLL)(Emu-TCL1 model) were due to an expansion of the inhibitory killer cell lectin-like receptor G1 (KLRG1) expressing cellular subset.
23966413 These results indicate that KLRG1 negatively regulates natural killer cell numbers and functions via the Akt pathway, thus providing a novel marker and therapeutic target for hepatitis C virus infection.
23740233 More T cells were KLRG1+ in the synovial fluid of patients with spondylarthritis/rheumatoid arthritis than crystal arthritis or controls. Those T cells were more functionally active, and migrated towards the synovial fluid of SpA/RA patients.
22684915 The lower inhibitory capacity of mKLRG1 compared with hKLRG1 can thus be rationalized by a decreased proportion of dimeric entities, which can be pinpointed to a single amino acid.
21933704 cytomegalovirus positive had lower proportions of NK-cells expressing inhibitory receptors (KLRG1 and CD158a)
21387286 trastuzumab-mediated antibody-dependent cellular cytotoxicity was markedly enhanced by KLRG1-negative peripheral blood mononuclear cells
20394788 Results demonstrated a substantial reduction in both CD94- and KLRG1- expressing CD3(-)CD56(+) NK cells with increased age.
More...

AA Sequence

MTDSVIYSMLELPTATQAQNDYGPQQKSSSSRPSCSCLVAIALGLLTAVLLSVLLYQWILCQGSNYSTCA      1 - 70
SCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSEAFCWIGLRNNSG     71 - 140
WRWEDGSPLNFSRISSNSFVQTCGAINKNGLQASSCEVPLHWVCKKCPFADQALF                   141 - 195
//

Text Mined References (32)

PMID Year Title
26014037 2015 TGF-? downregulates KLRG1 expression in mouse and human CD8(+) T cells.
25416956 2014 A proteome-scale map of the human interactome network.
24752778 2014 Transferrin' activation: bonding with transferrin receptors tunes KLRG1 function.
24337749 2014 KLRG1 impairs CD4+ T cell responses via p16ink4a and p27kip1 pathways: role in hepatitis B vaccine failure in individuals with hepatitis C virus infection.
24022692 2013 Expanded CD8+ T cells of murine and human CLL are driven into a senescent KLRG1+ effector memory phenotype.
23966413 2013 KLRG1 negatively regulates natural killer cell functions through the Akt pathway in individuals with chronic hepatitis C virus infection.
23740233 2014 Senescence marker killer cell lectin-like receptor G1 (KLRG1) contributes to TNF-? production by interaction with its soluble E-cadherin ligand in chronically inflamed joints.
22684915 2012 Different inhibitory capacities of human and mouse KLRG1 are linked to distinct disulfide-mediated oligomerizations.
21933704 2012 NK-cells have an impaired response to acute exercise and a lower expression of the inhibitory receptors KLRG1 and CD158a in humans with latent cytomegalovirus infection.
21387286 2011 E-cadherin expression on human carcinoma cell affects trastuzumab-mediated antibody-dependent cellular cytotoxicity through killer cell lectin-like receptor G1 on natural killer cells.
More...