Property Summary

NCBI Gene PubMed Count 12
Grant Count 531
R01 Count 290
Funding $60,900,498.92
PubMed Score 526.62
PubTator Score 11.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Synonym

Accession Q96E52 D3DQ54 Q5T3G6 Q5T3G7 Q5T3G8 Q5T3G9 Q5T3H0 Q8NBB3
Symbols DAB1
MPRP1
MPRP-1
YKR087C
ZMPOMA1
peptidase
2010001O09Rik

Gene

PANTHER Protein Class (3)

Gene RIF (7)

PMID Text
25275009 The mitochondrial metalloprotease OMA1 was activated in a Bax- and Bak-dependent fashion.
25112877 These findings demonstrate that (a) p53 and Oma1 mediate L-Opa1 processing, (b) mitochondrial fragmentation is involved in CDDP-induced apoptosis in OVCA and CECA cells, and (c) dysregulated mitochondrial dynamics
24719224 OMA1 is cleaved to a short form (S-OMA1) by itself upon mitochondrial membrane depolarization; S-OMA1 is degraded quickly but could be stabilized by CCCP treatment or Prohibitin knockdown in cells.
24634514 Cleavage of the inner membrane fusion factor L-OPA1 is prevented due to the failure to activate the inner membrane protease OMA1 in mitochondria that have a collapsed membrane potential.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20038677 OMA1 controls OPA1 cleavage and function.
17615298 These results provide evidence for different substrate specificities of m-AAA proteases composed of different subunits and reveal a striking evolutionary switch of proteases involved in the proteolytic processing of dynamin-like GTPases in mitochondria.

AA Sequence

MSFICGLQSAARNHVFFRFNSLSNWRKCNTLASTSRGCHQVQVNHIVNKYQGLGVNQCDRWSFLPGNFHF      1 - 70
YSTFNNKRTGGLSSTKSKEIWRITSKCTVWNDAFSRQLLIKEVTAVPSLSVLHPLSPASIRAIRNFHTSP     71 - 140
RFQAAPVPLLLMILKPVQKLFAIIVGRGIRKWWQALPPNKKEVVKENIRKNKWKLFLGLSSFGLLFVVFY    141 - 210
FTHLEVSPITGRSKLLLLGKEQFRLLSELEYEAWMEEFKNDMLTEKDARYLAVKEVLCHLIECNKDVPGI    211 - 280
SQINWVIHVVDSPIINAFVLPNGQMFVFTGFLNSVTDIHQLSFLLGHEIAHAVLGHAAEKAGMVHLLDFL    281 - 350
GMIFLTMIWAICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACADIRASSVFWQQM    351 - 420
EFVDSLHGQPKMPEWLSTHPSHGNRVEYLDRLIPQALKIREMCNCPPLSNPDPRLLFKLSTKHFLEESEK    421 - 490
EDLNITKKQKMDTLPIQKQEQIPLTYIVEKRTGS                                        491 - 524
//

Text Mined References (17)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25605331 2015 C11orf83, a mitochondrial cardiolipin-binding protein involved in bc1 complex assembly and supercomplex stabilization.
25275009 2014 Activation of mitochondrial protease OMA1 by Bax and Bak promotes cytochrome c release during apoptosis.
25112877 2014 p53 is required for cisplatin-induced processing of the mitochondrial fusion protein L-Opa1 that is mediated by the mitochondrial metallopeptidase Oma1 in gynecologic cancers.
24719224 2014 Membrane depolarization activates the mitochondrial protease OMA1 by stimulating self-cleavage.
24634514 2014 Impaired OMA1-dependent cleavage of OPA1 and reduced DRP1 fission activity combine to prevent mitophagy in cells that are dependent on oxidative phosphorylation.
22433842 2012 Loss of mitochondrial protease OMA1 alters processing of the GTPase OPA1 and causes obesity and defective thermogenesis in mice.
21220648 2011 Resequencing of 29 candidate genes in patients with familial and sporadic amyotrophic lateral sclerosis.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20038677 2009 Inducible proteolytic inactivation of OPA1 mediated by the OMA1 protease in mammalian cells.
More...