Property Summary

NCBI Gene PubMed Count 13
PubMed Score 54.69
PubTator Score 11.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (6)

Disease log2 FC p
aldosterone-producing adenoma -1.067 4.4e-02
intraductal papillary-mucinous adenoma (... 1.300 7.9e-04
osteosarcoma -1.202 5.0e-03
posterior fossa group A ependymoma 1.100 5.5e-08
psoriasis -1.100 7.4e-07
subependymal giant cell astrocytoma 1.486 3.4e-02

Gene RIF (8)

AA Sequence

MSFICGLQSAARNHVFFRFNSLSNWRKCNTLASTSRGCHQVQVNHIVNKYQGLGVNQCDRWSFLPGNFHF      1 - 70
YSTFNNKRTGGLSSTKSKEIWRITSKCTVWNDAFSRQLLIKEVTAVPSLSVLHPLSPASIRAIRNFHTSP     71 - 140
RFQAAPVPLLLMILKPVQKLFAIIVGRGIRKWWQALPPNKKEVVKENIRKNKWKLFLGLSSFGLLFVVFY    141 - 210
FTHLEVSPITGRSKLLLLGKEQFRLLSELEYEAWMEEFKNDMLTEKDARYLAVKEVLCHLIECNKDVPGI    211 - 280
SQINWVIHVVDSPIINAFVLPNGQMFVFTGFLNSVTDIHQLSFLLGHEIAHAVLGHAAEKAGMVHLLDFL    281 - 350
GMIFLTMIWAICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACADIRASSVFWQQM    351 - 420
EFVDSLHGQPKMPEWLSTHPSHGNRVEYLDRLIPQALKIREMCNCPPLSNPDPRLLFKLSTKHFLEESEK    421 - 490
EDLNITKKQKMDTLPIQKQEQIPLTYIVEKRTGS                                        491 - 524
//

Text Mined References (18)

PMID Year Title