Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.25
PubTator Score 0.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (3)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.400 1.4e-02
posterior fossa group B ependymoma 1.500 2.7e-07
psoriasis -1.200 1.8e-03

Gene RIF (1)

AA Sequence

MNEVKESLRSIEQKYKLFQQQQLTFTAALEHCRENAHDKIRPISSIGQVQSYMEHYCNSSTDRRVLLMFL      1 - 70
DICSELNKLCQHFEAVHSGTPVTNNLLEKCKTLVSQSNDLSSLRAKYPHDVVNHLSCDEARNHYGGVVSL     71 - 140
IPLILDLMKEWIAHSEKLPRKVLQHVSEPQAHQESTRGAARPAQAIGTQPRATKHKCRQLTKASLKPRGC    141 - 210
SKPPWRPPGGKL                                                              211 - 222
//

Text Mined References (9)

PMID Year Title