Tdark | RNA binding motif protein, X-linked-like-1 |
RNA-binding protein which may be involved in pre-mRNA splicing.
This gene represents a retrogene of RNA binding motif protein, X-linked (RBMX), which is located on chromosome X. While all introns in the coding sequence have been processed out compared to the RBMX locus, the ORF is intact and there is specific evidence for transcription at this location. The preservation of the ORF by purifying selection in all Old World monkeys carrying it suggests that this locus is likely to be functional, possibly during male meiosis when X chromosomal genes are silenced or during haploid stages of spermatogenesis. This gene shares 5' exon structure with the cysteine conjugate-beta lyase 2 locus on chromosome 1, but the coding sequences are non-overlapping. Alternative splicing results in two transcript variants. [provided by RefSeq, Jun 2009]
This gene represents a retrogene of RNA binding motif protein, X-linked (RBMX), which is located on chromosome X. While all introns in the coding sequence have been processed out compared to the RBMX locus, the ORF is intact and there is specific evidence for transcription at this location. The preservation of the ORF by purifying selection in all Old World monkeys carrying it suggests that this locus is likely to be functional, possibly during male meiosis when X chromosomal genes are silenced or during haploid stages of spermatogenesis. This gene shares 5' exon structure with the cysteine conjugate-beta lyase 2 locus on chromosome 1, but the coding sequences are non-overlapping. Alternative splicing results in two transcript variants. [provided by RefSeq, Jun 2009]
Comments
Disease | Target Count | P-value |
---|---|---|
Pick disease | 1893 | 1.81059898965559E-5 |
ovarian cancer | 8492 | 0.00140235247075607 |
Rheumatoid Arthritis | 1171 | 0.0153472847981887 |
Disease | log2 FC | p |
---|---|---|
Rheumatoid Arthritis | 1.600 | 0.015 |
Pick disease | 1.200 | 0.000 |
ovarian cancer | 1.300 | 0.001 |
MVEADRPGKLFIGGLNTETNEKALETVFGKYGRIVEVLLIKDRETNKSRGFAFVTFESPADAKDAARDMN 1 - 70 GKSLDGKAIKVEQATKPSFERGRHGPPPPPRSRGPPRGFGAGRGGSGGTRGPPSRGGHMDDGGYSMNFNM 71 - 140 SSSRGPLPVKRGPPPRSGGPSPKRSAPSGLVRSSSGMGGRAPLSRGRDSYGGPPRREPLPSRRDVYLSPR 141 - 210 DDGYSTKDSYSSRDYPSSRDTRDYAPPPRDYTYRDYGHSSSRDDYPSRGYGDRDGYGRDRDYSDHPSGGS 211 - 280 YRDSYESYGNSRSAPLTRGPPPSYGGSSRYDDYSSSRDGYGGSRDSYSSSRSDLYSSCDRVGRQERGLPP 281 - 350 SVERGYPSSRDSYSSSSRGAPRGAGPGGSRSDRGGGRSRY 351 - 390 //
PMID | Year | Title |
---|---|---|
25218447 | 2014 | Uncovering global SUMOylation signaling networks in a site-specific manner. |
24275569 | 2014 | An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. |
21406692 | 2011 | System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation. |
20068231 | 2010 | Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. |
19165527 | 2009 | Prefrontal cortex shotgun proteome analysis reveals altered calcium homeostasis and immune system imbalance in schizophrenia. |
18669648 | 2008 | A quantitative atlas of mitotic phosphorylation. |
17974005 | 2007 | The full-ORF clone resource of the German cDNA Consortium. |
16710414 | 2006 | The DNA sequence and biological annotation of human chromosome 1. |
16344560 | 2006 | Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes. |
16201836 | 2005 | Emergence of young human genes after a burst of retroposition in primates. |
More... |