Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.00
PubTator Score 1.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 6.6e-08
osteosarcoma 7950 1.1e-03

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.140 1.1e-03
ovarian cancer 1.500 6.6e-08

Synonym

Accession Q96E35 Q5T366
Symbols MIZIP

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MTDFKLGIVRLGRVAGKTKYTLIDEQDIPLVESYSFEARMEVDADGNGAKIFAYAFDKNRGRGSGRLLHE      1 - 70
LLWERHRGGVAPGFQVVHLNAVTVDNRLDNLQLVPWGWRPKAEETSSKQREQSLYWLAIQQLPTDPIEEQ     71 - 140
FPVLNVTRYYNANGDVVEEEENSCTYYECHYPPCTVIEKQLREFNICGRCQVARYCGSQCQQKDWPAHKK    141 - 210
HCRERKRPFQHELEPER                                                         211 - 227
//

Text Mined References (9)

PMID Year Title