Property Summary

NCBI Gene PubMed Count 14
Grant Count 10
R01 Count 10
Funding $785,550.2
PubMed Score 20.85
PubTator Score 13.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.790 0.002
active Crohn's disease 1.032 0.005
Breast cancer 3.100 0.029
Endometriosis -2.057 0.032
ovarian cancer 2.400 0.000

 GO Function (1)

Gene RIF (10)

PMID Text
25202063 Nogo-B receptor expression correlates negatively with malignancy grade and ki-67 antigen expression in invasive ductal breast carcinoma.
25173099 These findings provide new insights for understanding the roles of NgBR in regulating breast epithelial cell transform during the pathogenesis of breast cancer.
25075030 Significant NgBR mRNA down-regulation was associated with larger primary tumor size (p=0.039), lymph node involvement (p=0.039) and advancement stage (p=0.0054).
25066056 Described is a family with a congenital disorder of glycosylation caused by a loss of function mutation in the conserved C terminus of Nogo-B receptor - R290H.
24568601 Nogo-B receptor mediates pulmonary endothelial cell angiogenesis response through Akt/endothelial nitric oxide synthase pathway.
24223763 NgBR is a new molecular marker for breast cancer.
21572394 Nogo-B receptor (NgBR) is an essential component of the dolichol monophosophate (Dol-P) biosynthetic machinery. Loss of NgBR results in a robust deficit in cis-isoprenyltransferase (IPTase) activity and Dol-P production.
19723497 The Nogo-B receptor localizes primarily to the endoplasmic reticulum and regulates the stability of nascent Niemann-Pick type C2 protein.
17764014 In s-IBM muscle the Nogo-B increase may represent an attempt by muscle fiber to decrease A beta production. However, the increase of Nogo-B seems insufficient because A beta continues to accumulate and the disease progresses.
16835300 identify a previously uncharacterized Nogo-B receptor specific for the amino terminus of Nogo-B

AA Sequence

MTGLYELVWRVLHALLCLHRTLTSWLRVRFGTWNWIWRRCCRAASAAVLAPLGFTLRKPPAVGRNRRHHR      1 - 70
HPRGGSCLAAAHHRMRWRADGRSLEKLPVHMGLVITEVEQEPSFSDIASLVVWCMAVGISYISVYDHQGI     71 - 140
FKRNNSRLMDEILKQQQELLGLDCSKYSPEFANSNDKDDQVLNCHLAVKVLSPEDGKADIVRAAQDFCQL    141 - 210
VAQKQKRPTDLDVDTLASLLSSNGCPDPDLVLKFGPVDSTLGFLPWHIRLTEIVSLPSHLNISYEDFFSA    211 - 280
LRQYAACEQRLGK                                                             281 - 293
//

Text Mined References (14)

PMID Year Title
25202063 2014 Nogo-B receptor expression correlates negatively with malignancy grade and ki-67 antigen expression in invasive ductal breast carcinoma.
25173099 2015 Comprehensive proteome quantification reveals NgBR as a new regulator for epithelial-mesenchymal transition of breast tumor cells.
25075030 2014 Expression of Nogo isoforms and Nogo-B receptor (NgBR) in non-small cell lung carcinomas.
25066056 2014 Mutation of Nogo-B receptor, a subunit of cis-prenyltransferase, causes a congenital disorder of glycosylation.
24568601 2014 Nogo-B receptor modulates angiogenesis response of pulmonary artery endothelial cells through eNOS coupling.
24223763 2013 Expression of NgBR is highly associated with estrogen receptor alpha and survivin in breast cancer.
21572394 2011 Nogo-B receptor is necessary for cellular dolichol biosynthesis and protein N-glycosylation.
19723497 2009 Nogo-B receptor stabilizes Niemann-Pick type C2 protein and regulates intracellular cholesterol trafficking.
17764014 2007 NOGO is increased and binds to BACE1 in sporadic inclusion-body myositis and in A beta PP-overexpressing cultured human muscle fibers.
16835300 2006 Identification of a receptor necessary for Nogo-B stimulated chemotaxis and morphogenesis of endothelial cells.
More...